KEGG   Mahella australiensis: Mahau_1280Help
Entry
Mahau_1280        CDS       T01494                                 

Definition
glucan 1,4-alpha-glucosidase (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
mas  Mahella australiensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mas00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mahau_1280
Enzymes [BR:mas01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Mahau_1280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1334280..1336343
Genome map
AA seq 687 aa AA seqDB search
MYKIIKQVGGEAFGGPGNRPTWSTASKTGVGTAFNFYSKVWFTIARGIITEIYYPTLDTA
NTKSIRLIVVDKDSFVDEESEDMYHRVEFINPKALAYRLINTDKEKRYRIDKRIITDAMR
NSIIMKCRFEPLQGTLDDYSVYVFYEPHIDNSGYGDTGYITSYMGKPVLAAYDGCIHTAL
MTDVPWNAYSTGYIGVNDGLLDLKRNRRLNYQFDIAKDGNIGQIAELDMSRSNEFTVVLS
LGRNEFEASATGYATINDDYRAMEQEYIEGWNNYCGRLDVLDGKATQLYYTSMMVIKSYE
DKTHRGATIASMSVPWGEAASDENRGGYHLVWGRDLYHTAMAFIAAGDSITANRALEYLA
YVQQRDDGSFPQNSWLSGYPYWGGLQMDEVADAIILAWHLKRKDLYFKLVKPAADFICAR
GPATQQERWEENAGYSPATIAAEIAGLVCAGQLADDGGDIHGRDRYLEKADRWQKDVDRW
CFTTTGFHGSGQYYIRISPNGDPNCCDKVHLSNGAGEYDQREVVDASFLELVRLGVKRAD
DYHITETLRVVDELTKMHTGRGVGWYRYNHDGYGETEDCQPYCGVGKGRLWPVLTGERGH
YELAAGNDPTEYIRYMEQFANSGYMLPEQVWDDTGEPTGSATPLAWSHAEYVCLLASATH
RRIMDQPECVYQRYCADKMQLLLNSQG
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgtataagatcataaagcaggtgggaggagaagcgtttggaggacccggaaacaggcct
acatggtctacagccagcaaaactggcgtgggtacggctttcaatttttattccaaagta
tggtttaccatagcccgcggcattataacagagatctattaccctactttggataccgcc
aatactaaatccattcggctgatagtggtagacaaagacagctttgtggatgaggagtcg
gaagatatgtatcatagggttgaattcataaatccaaaggcactggcttatcgtctcata
aatactgataaagagaaacgctataggatcgataaacgcataataaccgatgccatgaga
aattcgattattatgaaatgccggtttgagcccctgcaaggcactttggacgattatagc
gtttatgtattttatgaaccgcatatagacaacagcggctatggtgataccggctatatt
acgtcatatatgggtaaacctgtgctggctgcatacgatggttgtatacacaccgctttg
atgacagatgtgccgtggaatgcttattcgaccggctatataggtgtaaatgatggtttg
cttgatttgaaacgcaacaggaggcttaattatcaattcgatatagctaaagatggcaat
ataggccagatagccgaattagacatgagccgcagtaatgaatttacagtggttttatcg
ttggggcgcaatgaatttgaagcatcggccacaggatatgctaccattaatgatgattat
agagccatggagcaggagtatatagaaggatggaataactattgcgggcgattggacgtc
ttggatggcaaggcgacgcagctatattatactagtatgatggtgataaagtcttatgag
gataagactcatagaggcgctacgatagcgtctatgagcgtaccatggggcgaagcggcc
agtgatgaaaatagaggaggttatcatcttgtgtgggggcgggatctttatcataccgcc
atggcatttatagccgccggcgatagcattacggccaatcgcgcacttgaatatctggct
tatgtgcagcagcgcgatgatgggagtttccctcagaattcatggctcagcggttatcca
tattggggaggcttgcagatggacgaagtggccgatgctataatattggcgtggcatcta
aaacgtaaagatctctatttcaaattagttaaaccggctgctgactttatatgtgctcga
gggccagctacgcagcaagaacgatgggaagagaacgccggctattcacctgccaccata
gcggctgaaatagccgggctggtatgcgcagggcaactggcagatgacggcggtgatatc
catggtcgcgatcgttatcttgagaaagccgatagatggcagaaggatgtggaccgctgg
tgttttaccaccacaggctttcatggcagtgggcaatattatatacgcataagcccaaac
ggcgatcccaattgctgtgataaagtgcatcttagcaatggtgccggggaatacgatcaa
cgggaagtggtggatgccagctttctggaattagtcaggctaggtgtaaaacgcgccgat
gattatcatataaccgaaacattgagggtggttgatgaactcacaaaaatgcatacgggc
aggggagtaggatggtatcgttataaccacgacggttatggtgaaacagaggattgtcaa
ccgtattgcggcgtggggaaaggacggctttggcctgtattgacaggtgaaagggggcat
tacgagctggctgcgggcaatgaccctacggaatatataagatatatggagcaatttgcc
aatagcggttatatgttgcctgagcaggtgtgggatgataccggtgagcctactggctca
gctactccgctagcatggagccatgctgaatacgtatgcctgctggcatcggccacacac
cggcgaataatggatcagccggagtgtgtataccagcgttattgcgctgacaaaatgcag
ttattgctaaactcgcaaggatga

DBGET integrated database retrieval system