KEGG   Mahella australiensis: Mahau_1329Help
Entry
Mahau_1329        CDS       T01494                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
mas  Mahella australiensis
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mas00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Mahau_1329
  Lipid metabolism
   00600 Sphingolipid metabolism
    Mahau_1329
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Mahau_1329
Enzymes [BR:mas01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Mahau_1329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1387709..1390789)
Genome map
AA seq 1026 aa AA seqDB search
MQCDWQNQYILTKNREPAHATLIPYADAGAAASFERGLSPYFKLLNGQWKFCYLPYPAAC
PMGFEQPEYDTQTWDEIPVPSNWQMLGYGKPNYTNVAYPYPVDPPYVPDDNPVGLYRRDF
EIPPSWQNRQVFLTFEGVDSAFRVWINGHEVGYSQGSHLPSEFNITPYVHAGGNALAVQV
YQWSDGSYLEDQDMWRLSGIFRDVYLIATPSVHMRDVHVDTILDDVCADAVLNVKTYIKN
YANHESENYTVIMELLDSDGQKVAKKDATAAPILGEEIIVDMETPVSDPHKWSAEDPYLY
TLILTLNDAEGNTEEIESFAVGFRKIEIKNQQLLVNGVSVKLKGVNRHDTHPDLGHAVSL
ESMIKDITLMKQHNINAVRTSHYPNDPRWLDLCDRYGLYVIDETDLECHGFAFTGNLNQI
SDDPEWEQAYVDRAERMVERDKNHPSIIIWSLGNESGYGRNHDAMAAWIRQHDTTRPIHY
EGAHDAPVVDIVSVMYPTVEKLAQEGQRTDDPRPFFMCEYAHAMGNGPGNLKEYWETIYK
YPRLIGGCVWEWVDHGIRQHTPSGEEWFAYGGDFGDEPNDGNFCIDGLNFPDRIPHTGLI
EYKKVLEPVKVDAIDMATGTFSISNLYNFISLRHLDGSWSLVSDGKTIQHGALPALDIAA
GQSMKITVPYTMPAAKAGTEYWINFSFTLNQDMLWAKRGFEIAWAQFKLPVEAPSVPIAV
SEMPELSCLQTDNTIEIAGHDFKLIFDKHYGRIASYNYNGMPMIHEGPRINLWRAPTDND
IHQAELWKRVGLDKLISRIADISFSMLCPQAAQIMVSYVLAPYSLTPVCRANVAYIVYGN
GDIEVDADISLRSDLPHLPRIGMEIQLPKGMEQFTWYGRGPHENYIDKKESARIDVYAGT
VDEQHVPYIRPQENGNKSDVRWAAVTNLRGMGWLIIGKPTFNISVHHYTTQDLTKADHTY
ELVHRDETIINIDYEQDGLGSNSCGPGPLEKYQLKPEDVSFSFILRPFSADAMSAVASSK
RYPQTI
NT seq 3081 nt NT seq  +upstreamnt  +downstreamnt
atgcaatgtgattggcaaaatcaatatatattgaccaaaaacagagagcctgcccacgct
accttgataccgtatgctgacgcaggtgctgctgcctctttcgaaagaggtctttcgccg
tatttcaagctgctgaatgggcaatggaaattttgttatctgccatatcccgcagcttgc
ccaatgggtttcgaacagcctgagtacgatacgcaaacgtgggatgaaattcctgtgccc
agcaattggcagatgctcggctacggtaagcccaactatactaatgtagcgtatccttat
cccgtggatccgccttacgttcctgacgacaatcctgtgggattatacaggcgtgatttt
gagataccgccatcgtggcagaacagacaggtctttttaacattcgagggcgtcgactcg
gccttcagagtatggataaacggtcacgaagtcggctatagccaaggcagtcatctgccg
tcggaattcaacatcacgccatacgtacatgcaggcggcaacgcgttggccgtacaggta
tatcaatggtcggatggtagttatctggaagaccaggacatgtggcgcttaagcggtata
ttccgcgatgtgtaccttatagccacaccaagcgtacacatgcgcgatgtgcacgtcgac
acaattcttgatgatgtgtgtgcggatgctgtactcaacgtaaaaacatacatcaaaaat
tatgcaaatcacgagagcgaaaactatacagtaataatggagctattagacagcgacggg
caaaaagtagccaaaaaagacgccacagctgccccaattttaggagaagaaatcatcgta
gatatggaaacgcccgtctctgatcctcataagtggtcagccgaagatccatatttgtac
acattgatactgactctaaatgatgccgaaggcaatacagaagaaatcgaaagttttgcc
gtgggcttccgcaaaatagagataaaaaatcagcaactattggtaaacggtgtatcagtg
aaattaaagggtgtgaacaggcatgatacacatccagaccttggccacgctgtatcgttg
gaatccatgatcaaggatataacgcttatgaagcagcataacataaacgctgtgagaaca
tctcactatccgaatgacccgcgttggctggatctgtgcgaccgttacggcctatatgtc
atagatgaaaccgatctcgaatgccacggatttgcatttacgggcaatctcaatcagatc
tccgacgacccggaatgggaacaggcttatgtggatagagccgagcgcatggtggagcgg
gataaaaatcatccatccatcatcatatggtcgctgggcaatgaatcaggctatggacgc
aatcacgatgctatggcagcctggatacgccaacacgatacgacgcggcccatacattat
gaaggtgctcacgacgcaccggtcgttgatatagtaagtgtcatgtaccccacagtggaa
aagcttgcacaagaaggacaaaggaccgatgacccacgcccatttttcatgtgcgaatat
gcgcatgctatgggcaacggccccggcaatctcaaagaatactgggaaaccatctataaa
tacccacggcttataggcggatgtgtctgggaatgggtggatcacggtatacgccaacat
acgccgtcaggggaggaatggtttgcatatggtggagatttcggagacgagccgaatgat
ggcaatttctgcatcgacggcttgaattttcccgaccgtataccccataccggccttatc
gaatataaaaaggtattagaaccggtaaaggtggatgctatagatatggcgacaggaaca
ttttccatcagcaatctatataatttcatatcgctgaggcacctcgatggcagttggtct
ctggtgagcgacggaaaaacgatacagcacggcgctctgcctgccctggatatagccgcc
ggccagtccatgaagataacagtaccttataccatgcctgccgctaaagcgggtaccgaa
tactggataaatttcagctttacattaaaccaagacatgctatgggccaaacgtggcttt
gaaatagcatgggcacaatttaagctgcctgtggaggcaccatccgtacctatagctgta
tcggaaatgccggaactaagctgtctgcaaaccgacaacactatagaaatagcaggccat
gattttaaattgatattcgataagcattatgggagaatagcatcttataattacaacggt
atgccaatgatacacgaaggcccacggataaatctgtggagagctcctaccgataacgat
atacatcaagcagaattatggaaaagagtgggattggacaagctgataagccgtattgct
gatatctcattttctatgctttgcccgcaagcggcacagattatggtatcatacgtctta
gccccatacagtttaacaccggtatgtcgtgctaatgttgcatatatcgtatacggtaac
ggtgatatagaagtagatgctgacatatcgctgcgttccgatctaccccatctgccgcgc
ataggcatggaaatacaattgccaaaaggtatggagcaatttacatggtatgggcgcggt
ccgcatgaaaattacatagataaaaaggaaagcgccagaatagacgtatatgccggcaca
gtggatgagcagcatgtaccctatatacgcccgcaggaaaacggcaataaatcggatgta
cgctgggctgctgttacgaatttgcgcggcatgggatggcttataattggaaaacctacg
tttaacataagcgtgcatcattacacgacacaggatctgaccaaggccgaccatacctat
gaactggtacatcgcgatgagactataatcaatatagattatgagcaagacggcctcggc
agcaatagctgtggtcccggtccattggaaaaataccagctcaagccggaggatgtgagc
ttcagcttcatattaagaccattttcggcagatgccatgtcggctgtagcatcgagcaaa
cgctatcctcaaacaatataa

DBGET integrated database retrieval system