KEGG   Mahella australiensis: Mahau_1369Help
Entry
Mahau_1369        CDS       T01494                                 

Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
mas  Mahella australiensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mas00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mahau_1369
   00030 Pentose phosphate pathway
    Mahau_1369
   00051 Fructose and mannose metabolism
    Mahau_1369
   00052 Galactose metabolism
    Mahau_1369
   00500 Starch and sucrose metabolism
    Mahau_1369
   00520 Amino sugar and nucleotide sugar metabolism
    Mahau_1369
  Nucleotide metabolism
   00230 Purine metabolism
    Mahau_1369
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mahau_1369
Enzymes [BR:mas01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Mahau_1369
    5.4.2.8  phosphomannomutase
     Mahau_1369
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1442652..1444022)
Genome map
AA seq 456 aa AA seqDB search
MSDIDRSMFRQYDIRGVFGEDLTEQAAVLLGKAFGTFARRHGKDTVIVGRDNRSSSLPLR
NAILEGLLSTGCSVLDIGLVTTPLCYYSRILYDIDPAVMITASHNPPQFNGFKVCYGPAT
LYGDDIQMLCDMIEKDDFIEGEGGTISYAYPMIDYINMICDKVKLGQRKLKVAVDCGNGT
ASLVHPQALYRLGCDVIPIYCDSDPRFPNHFPDPVKAENLEDLRKVVLDQKADLGIGFDG
DGDRIGLIDDKGNIIWGDTLMVLFWREILPKHPGTTAIVEVKCSQALAEEIERLGGKPMF
YKTGHSLIKAKMREIGSVFAGEMSGHMFFADEYYGFDDALYAAARLLRILSNTDKSLSEL
LTDVPRYPSTPELRIHCDDDKKFGIVEQAKAFFKDKGYPIIDVDGVRAIIDGGWGLIRAS
NTGPEIIVRCEAKTDEQLEDIKRMVSQAIAPLELTE
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatatagacagaagcatgttcagacaatacgatatacgcggcgtattcggtgag
gacctgaccgagcaggcggccgtgctgctgggcaaggcatttggcacatttgccaggcgc
catggcaaggataccgtcattgtaggcagagacaacaggtcttcatcattgccgctgcgc
aatgccatattggaaggcctactatcgaccggttgcagcgtattggatatagggctggtc
accacaccgctttgctactacagcaggatattatacgatatagaccccgctgtaatgata
acagccagccacaatccgccgcagttcaacggtttcaaggtctgctacgggccagccacg
ctgtacggcgatgacatacagatgctgtgcgatatgatagagaaagatgattttatcgag
ggtgaaggcggaacgatatcctacgcctaccccatgatagattatataaacatgatatgc
gataaggtaaagctggggcagcgcaagctcaaggtggctgtggactgcggcaacggtacg
gcgtcgctggtgcatccgcaggccctgtacaggctgggctgcgatgttataccaatatac
tgcgactcagatccgcgtttccctaatcatttccccgacccggtcaaggccgaaaacctt
gaggatttacgcaaggtggtattggaccaaaaggctgacctcggcataggctttgacggc
gacggcgaccggataggtttgatagatgacaaaggcaatatcatatggggcgatacgctg
atggtactgttctggcgcgagatattgcccaagcatccgggcactacagctatagtagag
gtcaaatgctcccaggctttggccgaagagatagagcgccttggcggcaagccgatgttc
tataagactgggcattcgctcataaaggcaaagatgcgcgagataggttcggtattcgcg
ggcgagatgtcgggccatatgttcttcgccgacgagtattacggcttcgacgacgcgctg
tacgctgccgcgcgcctattgaggatattgtccaatacagacaaatcgctatcggagctg
ctgaccgatgtgccgcgctatccatccacgcccgagcttaggatacactgcgatgatgat
aagaagttcggcatagtggaacaggccaaggcattctttaaggacaaggggtatccgatc
atagatgtcgatggcgtgcgcgccatcatagacggcggatgggggcttataagggcgtcc
aataccggccccgagataatagtgcgctgcgaggccaagaccgacgagcagttggaggat
ataaagcggatggtatcacaggccatagcgccgttagaattaacggaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system