KEGG   Mahella australiensis: Mahau_1416Help
Entry
Mahau_1416        CDS       T01494                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mas  Mahella australiensis
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mas00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1493974..1494783)
Genome map
AA seq 269 aa AA seqDB search
MYSDFKIKEEICEIGRRIYNRGFVAANDGNITVRVDDDEIWTTPTGVSKGFLTPDMLIKV
NMNGEVVSGSWKPSSELKMHLRVYKDRPDVRAVVHAHPPYATAFAIAGIPLTRCVMPEAV
ISLGTVPIAEYGTPSTEEIPNAIAKYLPNYDALLLENHGALTYGYDLMNAYFKMETLDFY
AQLLYLANNLGGAKDISPDNVEKLMHVREKMGIKGRHPGCEGCQYADGTCKIEENQSDSQ
SGSKQSTVKNDDIADIVAEVTRKVMEQLR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgtattctgattttaagataaaagaagagatatgcgagataggacgtcgcatatacaat
aggggttttgtagcagccaatgatggcaatataactgtaagggtagatgacgacgaaatt
tggactacccctaccggtgtcagcaaaggctttctgacaccggatatgttgatcaaggtc
aacatgaacggtgaagttgtaagcggtagctggaagccgtcgtccgaactcaaaatgcat
ttgagagtatacaaagacaggcctgacgttagagctgtagtacatgctcatccaccatat
gcaacagcctttgccatagccggcatacctctgacacgttgtgttatgcctgaggccgtt
atttcgctgggtacggtgcctatagccgaatatggtacaccttcaaccgaagaaatccca
aatgccatagccaaatatctgccgaattacgatgccttgttgctggaaaatcatggtgct
ctgacctacggctatgatctgatgaacgcctacttcaagatggaaacgctcgatttttac
gctcagttgttgtatctggctaataatcttggaggtgcaaaggacatatcgcccgacaat
gtggagaaattgatgcatgtaagggagaagatgggtataaagggacgtcatccgggttgt
gaagggtgccaatacgccgatggtacgtgcaaaatagaagaaaatcaatcggacagccaa
agcggatcaaaacaatcaactgtaaaaaatgacgatatagccgatatagtggctgaagtg
actaggaaagttatggaacagttaagataa

DBGET integrated database retrieval system