KEGG   Mahella australiensis: Mahau_1479Help
Entry
Mahau_1479        CDS       T01494                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mas  Mahella australiensis
Pathway
mas00010  Glycolysis / Gluconeogenesis
mas00051  Fructose and mannose metabolism
mas00562  Inositol phosphate metabolism
mas01100  Metabolic pathways
mas01110  Biosynthesis of secondary metabolites
mas01120  Microbial metabolism in diverse environments
mas01130  Biosynthesis of antibiotics
mas01200  Carbon metabolism
mas01230  Biosynthesis of amino acids
Module
mas_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mas_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mas00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mahau_1479
   00051 Fructose and mannose metabolism
    Mahau_1479
   00562 Inositol phosphate metabolism
    Mahau_1479
Enzymes [BR:mas01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mahau_1479
Exosome [BR:mas04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mahau_1479
  Exosomal proteins of bladder cancer cells
   Mahau_1479
  Exosomal proteins of melanoma cells
   Mahau_1479
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEE96670
UniProt: F3ZYC8
Position
complement(1554661..1555410)
Genome map
AA seq 249 aa AA seqDB search
MRKPIIAGNWKMNETPSQAVALINEIKPLVADAKCEVVVCPPFVCLPAAKDALKGSNIKL
GAQNMHWEEKGAYTGEISAPMLKEIGVEYVIIGHSERRQYFAETDQTVNNKVLAAFTHDL
TPIVCVGETLEQREAGQTETLVRNQIKEALEGLVTDAVRQVVIAYEPIWAIGTGRNASPE
DANDVIKIIRDTVAGMFGQDVAEAVRIQYGGSVNAKNAADLLAMSDIDGALVGGASLKAE
DFAIIVKAY
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagccaattattgctggtaactggaagatgaacgaaactccaagtcaagctgtc
gctttgataaatgaaataaagccattagtggcggatgcaaagtgtgaagtagtggtgtgt
ccgccttttgtgtgtctaccggcagctaaagatgctttgaagggctcaaatataaagctt
ggtgcgcaaaacatgcattgggaagaaaaaggtgcttatacaggtgagatatcagcgcct
atgttaaaagaaattggggtagaatacgttataatagggcattctgagcgacgtcagtat
tttgcggaaaccgatcaaacggttaacaataaagtattggcggcatttacacacgatctc
acccccatagtatgcgtaggagagacactggaacagcgtgaagctgggcagaccgaaaca
ttggttagaaatcaaattaaagaagctttggaaggattggtgaccgatgcggtacggcag
gtagttatagcatatgaacctatatgggctattggtaccggccgcaatgcgtcgcctgaa
gatgctaatgacgttataaagataatacgcgatactgtagctggtatgtttggccaagat
gtggccgaggccgtgaggatacagtatggtggaagcgtcaatgccaagaatgctgccgat
ttgctggccatgtccgacatagatggcgcattggtaggaggagccagcctaaaggctgaa
gactttgccataatagttaaagcttattga

DBGET integrated database retrieval system