KEGG   Mahella australiensis: Mahau_1595Help
Entry
Mahau_1595        CDS       T01494                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
mas  Mahella australiensis
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:mas00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Mahau_1595
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Mahau_1595
Enzymes [BR:mas01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Mahau_1595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1682155..1683609)
Genome map
AA seq 484 aa AA seqDB search
MELIKLLNDIEYYTVNGDVHLDIKNICYDSRKVTPGSLFVAIEGFKTDGHRFIRQAIDNG
AVAVVVTRDVPLPDGVSVVKVEDSRLSLAALSRAFYDYPDKQLHLIGVTGTNGKTSVTYM
VKSILEQSGRKVGLIGTIQNMIGDVVLHTERTTPESSDLYALFRQMADGGIQDVVMEVSS
HSLALNRVAGCRFDIGIFTNLTEDHLDFHSNMDDYFAAKLKLFQNSGLIATNVDDSYGVK
LKDMFVSKTVYTYGIEREAHVTASNILSDAKGSTFDIDICGDRRPVIINIPGRFSVYNAL
AAAAACYAMGVSADDISKGLQALKSVPGRFEVLGTDTDFTVIIDYAHTPDGLENILKSVK
DIAKGRVIALFGCGGDRDAAKRPIMGEIGGRYADFCILTSDNPRSEDPMAIIRQIEEGIR
KTHCPYIVIENRRQAIKYGLQTARKDDILLLAGKGHETYQILKDKTIHFDEREVVRELLE
DEKQ
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggaattgataaagttattaaatgatatagagtattatactgtaaacggagatgttcat
ttagatataaaaaatatatgctatgattcgcgcaaggtcacgccggggtctttatttgta
gcaatagaaggttttaaaaccgatggacatcggtttatacgccaagctatagacaacggt
gccgtagctgtagtggtaacccgtgatgttccactgcccgatggtgtatcggtagtaaag
gttgaggacagccgtttgtcgttggctgccttgtcgcgtgccttttatgactatccggat
aagcagctgcatcttataggggtgactggtacgaacggcaagaccagcgtgacatatatg
gtcaaatccatattggagcaaagcgggcgaaaggtaggccttataggtaccatacagaat
atgataggcgatgtggtactgcataccgaacgcactacgcctgaatcgtccgatttatat
gccttattcaggcaaatggccgatggtggcatacaggacgtggttatggaggtttcatcg
cattcgctggcattgaacagggtagccggttgtcgatttgatataggaatatttaccaat
ttaaccgaggatcatttggacttccatagcaatatggatgattattttgctgctaagcta
aaattatttcaaaatagcgggcttatagcgactaatgtagacgattcctatggtgtcaaa
ctaaaggacatgtttgtttccaaaaccgtatatacgtatggaatagagcgtgaagcgcat
gtgacagcctctaacatactcagcgatgctaaaggttctacttttgatattgatatatgc
ggcgatagaaggccggttataataaatatacccggccgtttcagcgtatataatgcgttg
gcggcagcagcagcatgctatgccatgggcgtatctgcggatgatatatcgaagggcctg
caagcactcaagagcgtacctggtcgatttgaagtgctgggcaccgacactgattttaca
gttatcatcgattatgctcatacgcccgatggtttagaaaatatactgaaatcggtcaaa
gatatagccaagggccgcgtgatagcgctattcggctgcggaggagacagggatgccgct
aagaggccgataatgggtgaaataggcggcaggtacgccgacttttgtatactgacatcc
gataatccaagaagcgaggatcctatggctattataaggcagattgaggaaggcatacgc
aaaactcactgcccttatattgttatagaaaatcgccgccaagccataaaatatgggctg
caaacggcgcgaaaagatgatatactattgttggccggtaaaggccatgagacgtatcag
atattgaaggataaaaccatacattttgatgagcgcgaggtagttcgtgagctattggag
gacgaaaagcagtga

DBGET integrated database retrieval system