KEGG   Mahella australiensis: Mahau_1834Help
Entry
Mahau_1834        CDS       T01494                                 

Definition
ROK family glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mas  Mahella australiensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mas00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mahau_1834
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mahau_1834
   00052 Galactose metabolism
    Mahau_1834
   00500 Starch and sucrose metabolism
    Mahau_1834
   00520 Amino sugar and nucleotide sugar metabolism
    Mahau_1834
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mahau_1834
   00524 Butirosin and neomycin biosynthesis
    Mahau_1834
Enzymes [BR:mas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Mahau_1834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1960450..1961409)
Genome map
AA seq 319 aa AA seqDB search
MLYVGVDLGGTKMAAGVVNDEGRILVRDTMPTGRERPFEVIAADMAKLILSVIQKGGYAI
DDISGIGIGSPGAIDNTNGIVIFANNFGWHNVPLRSELQKYIDLPIYMENDATVAGLAES
VYGAGKGVKNAITLTLGTGLGGGIIINGHIYSGSHHVGSELGHLIVEINGRQCTCGNRGC
WEQYASATALITAGKEAVLKYPDSLILKFAGGDPEKITAKTIEDAARAGDNVAAEVFDEY
VYYLTMGIISIINAFDPEMIIIGGGVSGAGDFLLKPLTEKVKEHIFYKELDFADIRLAEL
GNDAGIIGAAMLATDKYFI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgctctatgtaggtgtagatttaggcgggacaaaaatggctgccggcgtagtaaacgac
gaagggcgaatattggttcgcgataccatgccgacgggccgcgaaaggccgtttgaagtt
atagcggccgatatggctaaattgatactgtctgttatacaaaaaggtggttacgccata
gatgacataagcggtataggcatcggctcaccgggtgccatagataacaccaatggcata
gttatatttgccaataatttcggatggcataatgtgccgttgcgcagtgaattgcaaaaa
tatattgatttgcctatttatatggaaaacgatgctacagtagctggattagccgagagc
gtttatggcgcgggcaagggtgttaagaatgctatcacgctgacgctcggcaccggttta
ggcggcggcattataataaacgggcatatatacagcggaagccatcatgtgggcagcgaa
ttgggccatttgatagtggagataaacggtcgtcaatgtacatgcggtaaccggggctgc
tgggaacaatatgcctcagctacggcgcttataacggcaggtaaagaagctgtgcttaaa
taccccgattcgctgatattgaaattcgctggtggggatccggaaaaaataacggctaaa
accatagaagacgcggccagagcaggtgacaacgtggcggctgaagtattcgatgagtat
gtatattatcttaccatgggcataatatctattataaacgctttcgatcctgaaatgata
ataatagggggaggcgtatccggggccggcgactttttattaaaacctttgaccgaaaaa
gtaaaggagcatatattctataaagaattggattttgctgatataaggttggccgaattg
ggcaatgatgccggcataatcggtgcagctatgctggctaccgataaatatttcatttag

DBGET integrated database retrieval system