KEGG   Mahella australiensis: Mahau_1865Help
Entry
Mahau_1865        CDS       T01494                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mas  Mahella australiensis
Pathway
mas00010  Glycolysis / Gluconeogenesis
mas00030  Pentose phosphate pathway
mas00051  Fructose and mannose metabolism
mas00052  Galactose metabolism
mas00680  Methane metabolism
mas01100  Metabolic pathways
mas01110  Biosynthesis of secondary metabolites
mas01120  Microbial metabolism in diverse environments
mas01130  Biosynthesis of antibiotics
mas01200  Carbon metabolism
mas01230  Biosynthesis of amino acids
mas03018  RNA degradation
Module
mas_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mas00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mahau_1865
   00030 Pentose phosphate pathway
    Mahau_1865
   00051 Fructose and mannose metabolism
    Mahau_1865
   00052 Galactose metabolism
    Mahau_1865
  Energy metabolism
   00680 Methane metabolism
    Mahau_1865
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Mahau_1865
Enzymes [BR:mas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Mahau_1865
Protein phosphatases and associated proteins [BR:mas01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Mahau_1865
Messenger RNA biogenesis [BR:mas03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Mahau_1865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AEE97042
UniProt: F4A1C3
Position
complement(1989352..1990329)
Genome map
AA seq 325 aa AA seqDB search
MKTIGVLTSGGDAPGMNAAIRAVVRTGAYNDMRTLGIIRGFNGLIHDEIQELDISAVGDI
LHRGGTILKTARSEEFKTEAGMQKAMEIIKKYGIEGIVVIGGDGSFRGARDLSRLGVPTI
GLPGTIDNDIACTDYTIGFSTAINTVIDAINKLRDTASSHDRISIVEVMGRNAGDIALYS
GIAGGAESIIVPELPFETDEICRRIIQGRNRGKQHSIIVLAEGVVLNKEISGTIELGKEI
EAKTGLEVKVTILGHIQRGGSPTAFDRILASRMGARAVELLKQGIGNRVVGIRNNHIVDV
EVEEALTMKRSFNQDLYRLAQILSM
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaagacaataggcgttttaaccagcggtggagatgcgccaggcatgaatgcggctata
agggctgtagtgcgtaccggcgcatacaacgatatgaggactttaggtataataagggga
tttaacggccttattcacgatgagattcaagagttggatatatcagccgtgggcgatata
ttgcataggggtggcaccatcttaaagaccgctcgcagcgaagaatttaaaaccgaagcc
ggtatgcaaaaggcgatggaaattataaagaaatatggaatagagggtatcgtggtaata
ggaggcgacggttcattcagaggagccagagatttgagccgactgggcgtgcctaccata
gggttaccgggaactatagacaatgacatagcttgtacggattatactataggcttcagc
accgctattaataccgtgatcgatgccataaataaactgagggatactgcttcctcacat
gaccgaataagcattgtagaagtgatgggccgtaatgccggtgatatagctctttattcc
ggtatagccggcggagccgagagcattatagttcccgagctgccgtttgagacagatgag
atatgcaggcgcataatacaaggcagaaacaggggcaaacaacatagcatcatcgtattg
gctgaaggggtggtattaaacaaagaaataagcggtactatcgagctgggtaaggaaata
gaggctaaaacaggtttggaagttaaagtaaccatattaggccatatacaacgcggtggt
agtcctacggctttcgatagaatactggccagccgcatgggtgccagagcagtagaattg
ttgaagcagggtataggcaatcgagtagtgggtataagaaataatcatatagtggacgtt
gaagtagaagaagctttgactatgaaacgctcatttaatcaggatctatatcgattagcg
cagatcctgtcaatgtag

DBGET integrated database retrieval system