KEGG   Mahella australiensis: Mahau_1948Help
Entry
Mahau_1948        CDS       T01494                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mas  Mahella australiensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mas00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mahau_1948
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mahau_1948
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mahau_1948
Enzymes [BR:mas01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mahau_1948
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2071348..2072703)
Genome map
AA seq 451 aa AA seqDB search
MSDIKILLDENEIPTHWYNIQADMPNAVKPPLNPKTGQPAGPEDLSVIFPMELLKQEMSV
ERWIEIPEEVRELYRLWRPSPLYRAQRLEKALDTPAKIYYKYEGASPAGSHKLNTAIPQA
YYNKKAGIKRLATETGAGQWGSALAMACNFFGMECTVYMVKVSYQQKPYRRSMMQLFGAS
VIPSPSDKTQAGRDVLAKNPNSMGSLGVAISEAVEDAINHGDTNYALGSVLNHVVLHQTV
IGLEAKKQMEKAGYYPDVIIACSGGGSNFGGIAMPFVYDKIKEGKNTRIMAVEPTACPSL
TKGRFAYDYGDVAKLTPMMMMYTVGHDFMPPGIHAGGLRYHGASPLESQLMHDGLIEAKA
YDQREVFDAAKLFAQNEGIIPAPESSHAIKAAIDEALAAREAGKSRTILFNLSGHGYFDM
GAYDAYLSGRLQDSSLSEDELVRALEALPEV
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatattaagatattgcttgatgaaaacgaaatacctacccattggtacaatatc
caggctgatatgccaaatgcggtaaaaccaccgcttaatcccaaaaccggccaaccggct
gggccagaggacctttcggtgatctttcctatggagcttttaaagcaggagatgagcgtc
gagcgatggatagagattcctgaagaggtgcgcgagttgtataggttgtggagaccgtca
ccgttatatagggctcagcgattagaaaaggctttggatacaccggccaaaatatattat
aaatacgagggtgctagcccggccggcagccataaactaaatactgccataccgcaggct
tattataataaaaaggctggtataaagagattggccaccgagaccggagcgggtcaatgg
ggtagcgctctggctatggcgtgtaatttcttcgggatggaatgtacggtttatatggta
aaggtaagttaccagcagaagccatacaggcgttcaatgatgcagctatttggggcttct
gttataccgagtccaagtgataagacacaggctggcagggatgtattggctaagaacccg
aattctatgggcagcctgggtgtagctataagcgaggctgttgaggatgctattaaccat
ggcgacaccaattatgctctgggcagcgtgctcaatcacgtggtattgcatcaaaccgtt
ataggcttagaagccaaaaagcaaatggaaaaggccggctactatcctgatgtgataata
gcgtgctcgggtggcggcagcaatttcggcggtatagccatgccttttgtttacgataag
ataaaagagggtaaaaatacccgtataatggctgtggagcccacggcttgcccgagcctg
accaagggcaggtttgcctatgattacggtgatgtcgctaagttgacccctatgatgatg
atgtatacggtagggcatgattttatgccgccgggtatacatgcgggtggattgcgctat
catggtgcctcacctttagaaagccaactaatgcatgatggcttaatagaggctaaagcc
tatgatcagcgtgaggtatttgatgctgccaaactctttgcccagaatgagggcataata
ccggcgcctgaatcgtcgcatgccataaaagcggctatagatgaagctctggcagcaaga
gaagctggaaaatcgagaactatattgtttaacctaagtggtcacggctacttcgatatg
ggcgcttatgatgcgtatctgtctggccggttgcaggattcgtctttatcggaggacgaa
ttggtacgagcattggaggcattgcctgaggtataa

DBGET integrated database retrieval system