KEGG   Mahella australiensis: Mahau_2007Help
Entry
Mahau_2007        CDS       T01494                                 

Definition
(GenBank) thiamine pyrophosphate TPP-binding domain-containing protein
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
mas  Mahella australiensis
Pathway
mas00010  Glycolysis / Gluconeogenesis
mas00020  Citrate cycle (TCA cycle)
mas00620  Pyruvate metabolism
mas00633  Nitrotoluene degradation
mas00640  Propanoate metabolism
mas00650  Butanoate metabolism
mas00680  Methane metabolism
mas01100  Metabolic pathways
mas01120  Microbial metabolism in diverse environments
mas01130  Biosynthesis of antibiotics
mas01200  Carbon metabolism
Module
mas_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mas00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mahau_2007
   00020 Citrate cycle (TCA cycle)
    Mahau_2007
   00620 Pyruvate metabolism
    Mahau_2007
   00640 Propanoate metabolism
    Mahau_2007
   00650 Butanoate metabolism
    Mahau_2007
  Energy metabolism
   00680 Methane metabolism
    Mahau_2007
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mahau_2007
Enzymes [BR:mas01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mahau_2007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C DUF641
Motif
Other DBs
NCBI-ProteinID: AEE97183
UniProt: F4A244
Position
complement(2137383..2138318)
Genome map
AA seq 311 aa AA seqDB search
MPYNFKKTAQKPERFTGGHRMCAGCGAPVVVRTVLRALKPEDHAVIANATGCLEVSSSIY
PYSAWKDSYIHSAFENAAATVSGAEAAYVSLKKQGKIPYDTKFIAFGGDGGTYDIGFQSL
SGAMERGHDMVYVCYDNEAYMNTGIQRSSSTPKFADTTTSPAGSVIPGKLQYKKDLTKIM
AAHGIPYVAQSAPMKNFRDLYEKSEKAIYTQGPAFLNVLAPCPRGWRYDTPIMMELIEIA
VDTCVWPLYEVVNGEYHLSYKPKNKRPVEDWLKPQGRFKHLFAPQNRHLIDEFQAYVDKE
WDDLLKLCGEK
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgccatataattttaagaaaacagcgcagaagcctgaaaggtttacaggtggacataga
atgtgtgctggctgcggtgctcctgtggtagtgcgcactgtactccgcgcattgaagcct
gaagaccatgccgttatagccaatgctacaggctgtcttgaggtatccagcagcatatat
ccttattcagcatggaaggattcatatatacacagcgcttttgaaaacgctgcagccacg
gtgtcaggtgcggaagcggcatatgtttcactcaagaaacagggtaaaataccatatgat
actaaatttatagccttcggaggagacggcggtacctacgatataggctttcaatcattg
tcaggcgccatggagcgcgggcatgacatggtatatgtatgctatgataacgaggcctat
atgaataccggtatacagcgttcatcgtcaacgcctaagtttgccgataccaccacatcg
cctgcaggctcagtaataccgggtaaattgcagtataaaaaggatttgacaaagataatg
gcggcccatggcatcccgtatgtagcccagtcagcgccgatgaagaattttagggatttg
tatgagaaatccgaaaaggctatatatacacaaggaccagcattcttgaatgtattggct
ccgtgtccgagaggttggagatacgatacgcctataatgatggagcttatagaaatagca
gtggatacgtgcgtgtggccgctctatgaagttgtgaacggcgaatatcacctgagctat
aagccgaagaataaacgccccgtagaggactggctaaagccgcagggtaggtttaagcac
ctattcgcgccgcaaaaccgccaccttatagacgaattccaggcttatgtggataaagaa
tgggacgatctattaaagctatgtggtgaaaaataa

DBGET integrated database retrieval system