KEGG   Mahella australiensis: Mahau_2008Help
Entry
Mahau_2008        CDS       T01494                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, alpha subunit (EC:1.2.7.1)
  KO
K00169  
pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
mas  Mahella australiensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mas00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mahau_2008
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mahau_2008
   00020 Citrate cycle (TCA cycle)
    Mahau_2008
   00620 Pyruvate metabolism
    Mahau_2008
   00640 Propanoate metabolism
    Mahau_2008
   00650 Butanoate metabolism
    Mahau_2008
  Energy metabolism
   00680 Methane metabolism
    Mahau_2008
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mahau_2008
Enzymes [BR:mas01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mahau_2008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2138331..2139512)
Genome map
AA seq 393 aa AA seqDB search
MAIRERLSGNEAVAFAMRQIDPDVVAAFPITPSTEVPQYFSQFVANGQVHTEFVAVESEH
SAMSACIGAEAAGARTMTATSSQGLALMWEMLYIAASMRLPIVMTAVNRALSAPINIHND
HSDAMGARDSGWIQIYNETNQEAYDSLIMAIRVAEHADVQLPVMVCYDGFITSHSVENIM
LLEDELVKNFVGEYKPKYSLLDKEHPVSMGMFDLPAFYFEHKRQQAEAIKNAKQVLIDVQ
NEFAKISGRQYGLFEEYKLDDADIAIVIANSTAGTAKDTVDMLREQGIKAGLLKIRLFRP
FPADEIAKALSHVKAVAVMDKAEGFSAAGGPIFVDVRSAMYGKADGVKVINYIYGLGGRD
VGVYDIKQVYDHLQKIADSGQVDNLYNYLGIRE
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggccataagagaaagattaagtggcaatgaggcagtagcctttgccatgagacagata
gatccagatgtagtggcggcatttcctataacgccgtctacggaggtaccacaatacttt
tcccaatttgtagctaacggtcaggttcatacggaattcgtcgctgtagagagcgagcac
agcgccatgagcgcctgcataggtgccgaggctgccggagcgcgtaccatgacggctaca
tcgtcccagggtttggctctgatgtgggagatgctttacatagcagcatccatgcgctta
cccatcgttatgacagcggttaacagagcattgtccgcgcccataaacattcacaatgat
cacagcgatgctatgggtgccagggattccggatggatacagatatataatgaaaccaat
caggaggcctatgatagccttataatggctataagggtagccgagcatgcagatgtgcag
cttccggttatggtatgctatgacggctttataaccagccattcggtggaaaatataatg
ctgcttgaagatgaactggttaaaaatttcgtaggtgaatataaacccaaatattcgctt
ttggataaagaacacccggtaagcatgggtatgttcgatctgccggcattttatttcgag
cataagcgccaacaggctgaggctataaaaaatgcgaaacaagtgttgatcgacgtacaa
aacgaattcgccaagatttcagggcgccagtatggcctgtttgaggagtataagctcgac
gatgccgatatagctatagtgatagccaactctacggctggtacagccaaagatacagtg
gatatgctgcgcgagcagggcataaaggccggtttgttgaagatacgcttgttcaggcct
ttcccggctgatgagatagccaaagcattatcgcatgtcaaggcagtggccgttatggat
aaagcggagggattctcagcggcaggcggacctatattcgtcgatgtgcgcagcgctatg
tacggcaaagccgacggcgttaaggttataaattacatctacggtctgggaggccgtgac
gtcggtgtttatgatatcaaacaagtctacgatcacttgcagaagatagcggatagcggt
caagtagacaatttatataactatctaggtataagggaatag

DBGET integrated database retrieval system