KEGG   Mahella australiensis: Mahau_2009Help
Entry
Mahau_2009        CDS       T01494                                 

Definition
(GenBank) pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
mas  Mahella australiensis
Pathway
mas00010  Glycolysis / Gluconeogenesis
mas00020  Citrate cycle (TCA cycle)
mas00620  Pyruvate metabolism
mas00633  Nitrotoluene degradation
mas00640  Propanoate metabolism
mas00650  Butanoate metabolism
mas00680  Methane metabolism
mas01100  Metabolic pathways
mas01120  Microbial metabolism in diverse environments
mas01130  Biosynthesis of antibiotics
mas01200  Carbon metabolism
Module
mas_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mas00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mahau_2009
   00020 Citrate cycle (TCA cycle)
    Mahau_2009
   00620 Pyruvate metabolism
    Mahau_2009
   00640 Propanoate metabolism
    Mahau_2009
   00650 Butanoate metabolism
    Mahau_2009
  Energy metabolism
   00680 Methane metabolism
    Mahau_2009
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mahau_2009
Enzymes [BR:mas01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mahau_2009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_10 Fer4_2 Fer4_7 Fer4_9 Fer4_6 Fer4_16 Fer4_15 Fer4_13 Fer4_4 Fer4_17 Fer4_3 Fer4_22
Motif
Other DBs
NCBI-ProteinID: AEE97185
UniProt: F4A246
Position
complement(2139532..2139843)
Genome map
AA seq 103 aa AA seqDB search
MNEVKKIEEINEDISWRDITPGGVAPWAGGAETFTTGDWRTMRPVLIEDKCTGCLLCWPT
CPDTSIIPTDDGKIKYDYDHCKGCGVCVEVCPFDAIDFVEDIS
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaagtaaaaaaaatagaagaaattaatgaggatataagctggcgcgacataacg
ccgggaggcgtggcaccgtgggcaggaggtgcagaaaccttcaccactggggattggcgt
accatgcgccctgtgttgatcgaggataaatgcaccggttgtcttttgtgttggccgact
tgtccagatacgtcgataataccaactgatgatggtaaaatcaaatatgactatgatcac
tgcaagggctgcggcgtatgtgtggaggtatgcccgttcgatgcaatagattttgtagag
gatatatcttaa

DBGET integrated database retrieval system