KEGG   Mahella australiensis: Mahau_2010Help
Entry
Mahau_2010        CDS       T01494                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
mas  Mahella australiensis
Pathway
mas00010  Glycolysis / Gluconeogenesis
mas00020  Citrate cycle (TCA cycle)
mas00620  Pyruvate metabolism
mas00633  Nitrotoluene degradation
mas00640  Propanoate metabolism
mas00650  Butanoate metabolism
mas00680  Methane metabolism
mas01100  Metabolic pathways
mas01120  Microbial metabolism in diverse environments
mas01130  Biosynthesis of antibiotics
mas01200  Carbon metabolism
Module
mas_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mas00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mahau_2010
   00020 Citrate cycle (TCA cycle)
    Mahau_2010
   00620 Pyruvate metabolism
    Mahau_2010
   00640 Propanoate metabolism
    Mahau_2010
   00650 Butanoate metabolism
    Mahau_2010
  Energy metabolism
   00680 Methane metabolism
    Mahau_2010
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mahau_2010
Enzymes [BR:mas01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mahau_2010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR
Motif
Other DBs
NCBI-ProteinID: AEE97186
UniProt: F4A247
Position
complement(2139840..2140418)
Genome map
AA seq 192 aa AA seqDB search
MGKMIEIRWHGRGGQGAKTASLLLAEALFNTGKYIQGFPEYGPERSGAPLTAYNRISDEP
IRVHSNIYEPDYVVVVDETLLASVDVTAGLKETGGIVVNTPKSPEEIRHYLKDYKGKVGT
VDAKKISEEELGRYFPNVPMLGAIMAMTGLVEKEQFIKSMEESFHHKFATKPEVIDGNVR
ALKRAMEEVRIS
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagatgatagagatccgttggcatggccgtggaggccaaggtgcaaagacggct
tcgttgcttttagccgaggcgctcttcaacaccggtaaatatattcagggcttccccgaa
tatggtcccgaacgttccggcgcaccgctcacagcttataacaggataagcgatgagcct
ataagggtgcattccaatatctatgaacccgattatgtggtagtagtggacgaaacactt
cttgcatcggtggatgttacagccggtctaaaagaaacaggtggtatagtcgtaaatacc
cctaagtcgcccgaggaaataaggcattatctaaaggattacaaaggtaaagtgggtaca
gtcgatgccaagaagatatccgaagaagagttgggtaggtattttcccaacgttccgatg
ttgggagctataatggctatgactggtttagtcgagaaggaacagtttataaaaagtatg
gaagagtcattccatcataaattcgccaccaagcccgaggttatagatggcaatgtgcgg
gctttgaagagggcgatggaggaggtaagaatatcatga

DBGET integrated database retrieval system