KEGG   Mahella australiensis: Mahau_2010Help
Entry
Mahau_2010        CDS       T01494                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, gamma subunit (EC:1.2.7.1)
  KO
K00172  
pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
mas  Mahella australiensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mas00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mahau_2010
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mahau_2010
   00020 Citrate cycle (TCA cycle)
    Mahau_2010
   00620 Pyruvate metabolism
    Mahau_2010
   00640 Propanoate metabolism
    Mahau_2010
   00650 Butanoate metabolism
    Mahau_2010
  Energy metabolism
   00680 Methane metabolism
    Mahau_2010
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mahau_2010
Enzymes [BR:mas01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mahau_2010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2139840..2140418)
Genome map
AA seq 192 aa AA seqDB search
MGKMIEIRWHGRGGQGAKTASLLLAEALFNTGKYIQGFPEYGPERSGAPLTAYNRISDEP
IRVHSNIYEPDYVVVVDETLLASVDVTAGLKETGGIVVNTPKSPEEIRHYLKDYKGKVGT
VDAKKISEEELGRYFPNVPMLGAIMAMTGLVEKEQFIKSMEESFHHKFATKPEVIDGNVR
ALKRAMEEVRIS
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagatgatagagatccgttggcatggccgtggaggccaaggtgcaaagacggct
tcgttgcttttagccgaggcgctcttcaacaccggtaaatatattcagggcttccccgaa
tatggtcccgaacgttccggcgcaccgctcacagcttataacaggataagcgatgagcct
ataagggtgcattccaatatctatgaacccgattatgtggtagtagtggacgaaacactt
cttgcatcggtggatgttacagccggtctaaaagaaacaggtggtatagtcgtaaatacc
cctaagtcgcccgaggaaataaggcattatctaaaggattacaaaggtaaagtgggtaca
gtcgatgccaagaagatatccgaagaagagttgggtaggtattttcccaacgttccgatg
ttgggagctataatggctatgactggtttagtcgagaaggaacagtttataaaaagtatg
gaagagtcattccatcataaattcgccaccaagcccgaggttatagatggcaatgtgcgg
gctttgaagagggcgatggaggaggtaagaatatcatga

DBGET integrated database retrieval system