KEGG   Mahella australiensis: Mahau_2335Help
Entry
Mahau_2335        CDS       T01494                                 

Definition
(GenBank) acetaldehyde dehydrogenase; alcohol dehydrogenase AdhE
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
mas  Mahella australiensis
Pathway
mas00010  Glycolysis / Gluconeogenesis
mas00350  Tyrosine metabolism
mas00620  Pyruvate metabolism
mas00625  Chloroalkane and chloroalkene degradation
mas00626  Naphthalene degradation
mas00650  Butanoate metabolism
mas01100  Metabolic pathways
mas01110  Biosynthesis of secondary metabolites
mas01120  Microbial metabolism in diverse environments
mas01130  Biosynthesis of antibiotics
mas01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mas00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mahau_2335
   00620 Pyruvate metabolism
    Mahau_2335
   00650 Butanoate metabolism
    Mahau_2335
  Lipid metabolism
   00071 Fatty acid degradation
    Mahau_2335
  Amino acid metabolism
   00350 Tyrosine metabolism
    Mahau_2335
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mahau_2335
   00626 Naphthalene degradation
    Mahau_2335
Enzymes [BR:mas01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Mahau_2335
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Mahau_2335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2 ATLF Sigma70_r4_2
Motif
Other DBs
NCBI-ProteinID: AEE97501
UniProt: F3ZW92
Position
2485001..2487604
Genome map
AA seq 867 aa AA seqDB search
MKPEERNHAAQPVSIDAMINKLVNRASTAAEAYMQMDQEQIDTIVKAMAVAAMDNHMALA
KAAVEETKRGVYEDKITKNMFAAEYIYHDIKYQKTVGVINENKLEGYIEIAEPVGIIAGI
TPVTNPTSTTIFKSLIAVKTRNPIIFAFHPSAQKSSSMAAQVLLKAAIEAGAPKYCIQWI
EEPSLEATAALINHPGISLILATGGSNMVKAAYSAGKPALGVGPGNVPCYIDQSAELETA
LTDLMLSKTFDNGMICASEQSVIFHKAIADKAIEFLKSHNCYVLNKNEVELLTAVAMNKE
KGGVNPAIVGQSAVTIAKMAGLKVPESTRILIAPLDGIGSQYPLSGEKLSPILALYIAKD
YKEAIEMAKQLISYGGIGHSAAIHSKDKEVIKEFSKALKVSRIVVNAPSSHGAIGDIYNS
LVPSLTLGCGTYGGNSTSDNVSSVNLINVKRVAARRYNMQWFKVPEKIYFEPGAIGYLEK
MPDISRAFIVTDAAMVKLGYTDRILYYLRKHSPYVHSEIFADVEPDPSVDTIMRGVELMN
SFQPDVIIALGGGSAIDAAKGMWLYYEHPEVDFANLKLKFMDIRKRVYKFPRLGNKAKLV
AIPTTSGTGSEVTSFAVITDKEKGVKYPLADYELTPDVAIIDPDLVMTVPPTITADTGMD
VLTHAIEAYVSVMASDYTDALAIKAIQLVFEYLPRAYKNGNDSEAREKMHNASCMAGMAF
TNAFLGINHSLAHKLGGEFHIPHGRANAVLLPYVIEYNAKEPEKLASFPKYGKFVADKRY
AEISRMLGLPASTVQEGVNSLIKAIRDLMTALNMPHTIAQCGVSREEFEAKVNELAEKAF
EDQCTTANPKLPLIRDLVDIYMKAYNG
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccagaagaaagaaatcatgctgctcagccggttagtatagacgctatgataaat
aaattggtaaaccgagcgtctactgcagcagaagcttatatgcaaatggatcaggaacaa
atagacactatagtgaaagccatggccgtagcagctatggataatcatatggcgctggcc
aaagccgctgtggaagaaaccaagcgtggcgtatatgaagataagataactaaaaatatg
tttgctgcggaatacatttatcatgatataaagtatcaaaaaacggtgggggttataaat
gaaaataagttggagggctatatagagatagccgagccagtgggtataatagctggtatc
acaccggtgaccaatccaacttctacgaccatattcaaatcgctcatagcggtaaaaaca
cgtaatcccataatattcgcttttcatccatctgctcaaaaatccagcagtatggcagcc
caggtactgttaaaagccgctatagaagcaggggcaccgaaatactgcatacaatggata
gaggagccatctttagaagccactgccgcactaataaatcatcccggcatatcgcttata
ctggccaccggcggcagtaatatggttaaagccgcatacagcgcgggcaaaccggcttta
ggcgtcggaccaggtaacgtaccgtgctatatagatcagagcgctgaacttgaaacagcg
ctgaccgacctcatgctgtccaaaacattcgataatggcatgatatgcgcttcagagcaa
tcggtcatatttcataaagccattgctgataaagccatagaatttttgaaatcccacaat
tgctatgtattgaataaaaacgaggtagagctattgactgccgtcgctatgaataaagaa
aaaggcggtgtaaatccagcgatagtaggacagtccgctgtaacaatagctaagatggcc
ggccttaaagtaccagaaagtacaagaatattaatagcgccactagacggcattggtagt
caatacccgttatcaggggaaaaactcagccctatattagctttatatatagcaaaagat
tataaagaagctatagaaatggcaaaacagttgatttcgtatggcggtatagggcattcg
gctgccatacattcgaaagataaagaagtcataaaagagttctcaaaggctttgaaagtc
agtcgcatagtagtaaacgccccttccagccatggtgccataggtgatatatataatagc
ctggttccgtcattaacccttggctgtggcacttatggaggcaattcgaccagcgataat
gtatcttcggtaaaccttataaatgtaaagcgcgtggctgcacgccggtacaatatgcaa
tggtttaaagtgccggaaaaaatatacttcgaaccgggagccataggctatctagagaaa
atgcccgacatatccagggcgttcatcgtaaccgatgctgcaatggtaaagcttggctat
acagaccgcatattgtattacctcaggaagcattctccatatgtgcacagcgagatattc
gctgatgtggaaccagacccgtcagtagataccataatgcgcggcgtagaactaatgaat
agcttccagcctgacgtcatcatagccctaggcggaggatcagctatagatgccgcaaag
ggcatgtggctgtactatgagcatccagaagtagatttcgccaacctcaaattgaagttt
atggacataagaaagcgcgtatacaagttcccacgactaggtaataaagcaaagttagtc
gccataccgaccacatcgggcaccggctctgaagtaacctcttttgccgttataaccgat
aaagagaaaggcgtgaagtatcctctggcagattatgaattaacgccggatgtagctata
atagatccggacctagtaatgacagtaccgcctactattactgcagataccggtatggac
gtattaacccacgctatagaagcatatgtatcggtaatggcatcagattatacagatgcc
cttgcaataaaggctatacaactggtttttgaatacctgccgcgggcatataaaaacggt
aatgacagcgaagcaagagagaaaatgcataatgcttcttgcatggcaggcatggctttc
accaacgcatttctcggcataaaccacagccttgcccacaagctgggcggcgagtttcat
ataccccacggtcgtgctaatgccgtgttgctgccatatgtaatagaatacaatgccaaa
gagcccgaaaagctagcatctttccccaaatacggcaagttcgtggccgataaaagatat
gccgaaatatccaggatgcttggactgcctgcttccactgtacaagaaggcgtaaatagc
ctcataaaagctatacgcgatttgatgacggctctaaatatgccgcataccatagcgcaa
tgcggggtcagccgcgaagagttcgaagccaaagtcaatgaattggctgaaaaagccttt
gaagatcagtgcacgacagccaatccgaagcttccccttataagagacctcgtagatata
tatatgaaagcatacaatggctaa

DBGET integrated database retrieval system