KEGG   Mahella australiensis: Mahau_2335Help
Entry
Mahau_2335        CDS       T01494                                 

Definition
acetaldehyde dehydrogenase (EC:1.1.1.1 1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
mas  Mahella australiensis
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mas00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Mahau_2335
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mahau_2335
   00620 Pyruvate metabolism
    Mahau_2335
   00650 Butanoate metabolism
    Mahau_2335
  Lipid metabolism
   00071 Fatty acid degradation
    Mahau_2335
  Amino acid metabolism
   00350 Tyrosine metabolism
    Mahau_2335
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mahau_2335
   00626 Naphthalene degradation
    Mahau_2335
Enzymes [BR:mas01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Mahau_2335
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Mahau_2335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2485001..2487604
Genome map
AA seq 867 aa AA seqDB search
MKPEERNHAAQPVSIDAMINKLVNRASTAAEAYMQMDQEQIDTIVKAMAVAAMDNHMALA
KAAVEETKRGVYEDKITKNMFAAEYIYHDIKYQKTVGVINENKLEGYIEIAEPVGIIAGI
TPVTNPTSTTIFKSLIAVKTRNPIIFAFHPSAQKSSSMAAQVLLKAAIEAGAPKYCIQWI
EEPSLEATAALINHPGISLILATGGSNMVKAAYSAGKPALGVGPGNVPCYIDQSAELETA
LTDLMLSKTFDNGMICASEQSVIFHKAIADKAIEFLKSHNCYVLNKNEVELLTAVAMNKE
KGGVNPAIVGQSAVTIAKMAGLKVPESTRILIAPLDGIGSQYPLSGEKLSPILALYIAKD
YKEAIEMAKQLISYGGIGHSAAIHSKDKEVIKEFSKALKVSRIVVNAPSSHGAIGDIYNS
LVPSLTLGCGTYGGNSTSDNVSSVNLINVKRVAARRYNMQWFKVPEKIYFEPGAIGYLEK
MPDISRAFIVTDAAMVKLGYTDRILYYLRKHSPYVHSEIFADVEPDPSVDTIMRGVELMN
SFQPDVIIALGGGSAIDAAKGMWLYYEHPEVDFANLKLKFMDIRKRVYKFPRLGNKAKLV
AIPTTSGTGSEVTSFAVITDKEKGVKYPLADYELTPDVAIIDPDLVMTVPPTITADTGMD
VLTHAIEAYVSVMASDYTDALAIKAIQLVFEYLPRAYKNGNDSEAREKMHNASCMAGMAF
TNAFLGINHSLAHKLGGEFHIPHGRANAVLLPYVIEYNAKEPEKLASFPKYGKFVADKRY
AEISRMLGLPASTVQEGVNSLIKAIRDLMTALNMPHTIAQCGVSREEFEAKVNELAEKAF
EDQCTTANPKLPLIRDLVDIYMKAYNG
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccagaagaaagaaatcatgctgctcagccggttagtatagacgctatgataaat
aaattggtaaaccgagcgtctactgcagcagaagcttatatgcaaatggatcaggaacaa
atagacactatagtgaaagccatggccgtagcagctatggataatcatatggcgctggcc
aaagccgctgtggaagaaaccaagcgtggcgtatatgaagataagataactaaaaatatg
tttgctgcggaatacatttatcatgatataaagtatcaaaaaacggtgggggttataaat
gaaaataagttggagggctatatagagatagccgagccagtgggtataatagctggtatc
acaccggtgaccaatccaacttctacgaccatattcaaatcgctcatagcggtaaaaaca
cgtaatcccataatattcgcttttcatccatctgctcaaaaatccagcagtatggcagcc
caggtactgttaaaagccgctatagaagcaggggcaccgaaatactgcatacaatggata
gaggagccatctttagaagccactgccgcactaataaatcatcccggcatatcgcttata
ctggccaccggcggcagtaatatggttaaagccgcatacagcgcgggcaaaccggcttta
ggcgtcggaccaggtaacgtaccgtgctatatagatcagagcgctgaacttgaaacagcg
ctgaccgacctcatgctgtccaaaacattcgataatggcatgatatgcgcttcagagcaa
tcggtcatatttcataaagccattgctgataaagccatagaatttttgaaatcccacaat
tgctatgtattgaataaaaacgaggtagagctattgactgccgtcgctatgaataaagaa
aaaggcggtgtaaatccagcgatagtaggacagtccgctgtaacaatagctaagatggcc
ggccttaaagtaccagaaagtacaagaatattaatagcgccactagacggcattggtagt
caatacccgttatcaggggaaaaactcagccctatattagctttatatatagcaaaagat
tataaagaagctatagaaatggcaaaacagttgatttcgtatggcggtatagggcattcg
gctgccatacattcgaaagataaagaagtcataaaagagttctcaaaggctttgaaagtc
agtcgcatagtagtaaacgccccttccagccatggtgccataggtgatatatataatagc
ctggttccgtcattaacccttggctgtggcacttatggaggcaattcgaccagcgataat
gtatcttcggtaaaccttataaatgtaaagcgcgtggctgcacgccggtacaatatgcaa
tggtttaaagtgccggaaaaaatatacttcgaaccgggagccataggctatctagagaaa
atgcccgacatatccagggcgttcatcgtaaccgatgctgcaatggtaaagcttggctat
acagaccgcatattgtattacctcaggaagcattctccatatgtgcacagcgagatattc
gctgatgtggaaccagacccgtcagtagataccataatgcgcggcgtagaactaatgaat
agcttccagcctgacgtcatcatagccctaggcggaggatcagctatagatgccgcaaag
ggcatgtggctgtactatgagcatccagaagtagatttcgccaacctcaaattgaagttt
atggacataagaaagcgcgtatacaagttcccacgactaggtaataaagcaaagttagtc
gccataccgaccacatcgggcaccggctctgaagtaacctcttttgccgttataaccgat
aaagagaaaggcgtgaagtatcctctggcagattatgaattaacgccggatgtagctata
atagatccggacctagtaatgacagtaccgcctactattactgcagataccggtatggac
gtattaacccacgctatagaagcatatgtatcggtaatggcatcagattatacagatgcc
cttgcaataaaggctatacaactggtttttgaatacctgccgcgggcatataaaaacggt
aatgacagcgaagcaagagagaaaatgcataatgcttcttgcatggcaggcatggctttc
accaacgcatttctcggcataaaccacagccttgcccacaagctgggcggcgagtttcat
ataccccacggtcgtgctaatgccgtgttgctgccatatgtaatagaatacaatgccaaa
gagcccgaaaagctagcatctttccccaaatacggcaagttcgtggccgataaaagatat
gccgaaatatccaggatgcttggactgcctgcttccactgtacaagaaggcgtaaatagc
ctcataaaagctatacgcgatttgatgacggctctaaatatgccgcataccatagcgcaa
tgcggggtcagccgcgaagagttcgaagccaaagtcaatgaattggctgaaaaagccttt
gaagatcagtgcacgacagccaatccgaagcttccccttataagagacctcgtagatata
tatatgaaagcatacaatggctaa

DBGET integrated database retrieval system