KEGG   Mahella australiensis: Mahau_2338Help
Entry
Mahau_2338        CDS       T01494                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mas  Mahella australiensis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mas00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Mahau_2338
Enzymes [BR:mas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Mahau_2338
Exosome [BR:mas04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mahau_2338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2490783..2492270
Genome map
AA seq 495 aa AA seqDB search
MEQYIIALDEGTTSCRAVAFNREGCTVAMRSRQFRQIYPQSGWVEHDAMEIWNAQLNALK
ELIRDLDLSPAQIAAIGIADQRETVVLWDKHTGKPVYNAIVWQCRRTAPLCDDLKQSGIT
EVVHKKTGLVIDAYFSATKIRWIMDNIPGVKEAAANGNILAGTIDTWLLWNLTGGKAHAT
DYSNASRTMLYNINELCWDEDILNMLDIPQAILPEVKPSSCTFGYTDPSILGASIPIAGI
AGDQQAALFGQLCLQPGMIKNTYGTGCFILMNTGDKPIYSSNNLLTTIAWGIDGKVEYAL
EGSVFSAGASVQWLRDGLKIIDNAAQSQQYAEAVADNGGVYVVPAFTGLGAPYWDMYARG
LIIGISRGTQRQHIVRATLESIAYQTMDILDTMQRDATLPFKNLRVDGGACANDFLMQFQ
ADILGIEVERPPIVETTALGAAYLAGLEVGYWNKDALNAVWIPSKVFKPQMSDEQRFQLS
QRWHEAVKRALSWAR
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggaacaatatataatcgcattggatgaagggactacaagttgccgggctgtggctttc
aatcgtgagggttgcactgtagccatgcgcagccgtcagttcaggcaaatctatcctcaa
tcgggatgggtggaacacgatgctatggaaatatggaacgctcaactgaatgcgctaaag
gagttgatacgcgatctggacctttcaccggcacagatagcagccataggtatagccgat
caacgtgaaacggtagtattatgggataagcatacaggaaaacctgtatataacgccata
gtatggcaatgcaggcgtacagcgcctttatgcgatgatctgaaacaaagcggcataact
gaagtcgtacataaaaagaccggtttggttatcgatgcgtatttctccgccactaaaata
agatggataatggataacatacctggcgtaaaagaagcggcagcaaatgggaatatacta
gccggcactatagatacatggcttttatggaatctgactggcggtaaagcgcatgccacc
gattattcgaatgccagtcgtaccatgctgtataatataaacgagttatgttgggacgaa
gatatattgaatatgctggacataccacaagccatattgcccgaggtcaagccttcgtcg
tgcacatttggctacacggatccttcgatcctgggtgcttctatacccatagccggcata
gccggcgatcagcaggccgccttattcgggcagttatgcctgcaacctggtatgataaag
aatacatacggtaccggttgctttatactgatgaatacaggcgataaacctatttattcg
tctaacaatctgttaaccacaatagcatgggggatagacggcaaagtggagtatgcgctg
gagggcagcgtattctcggccggggcgtctgttcagtggttgcgcgacggcctaaagata
atagataatgccgctcagagccagcaatatgccgaggctgtagctgacaacggcggggta
tacgtagtgccggcttttaccggcttaggcgcaccttactgggatatgtatgctcgaggt
ttaataataggcatcagccgcggcacacagcgccaacatatcgtgcgggccaccctggaa
agcatagcctatcagaccatggatatattggataccatgcagcgcgatgccacgctgcca
tttaaaaacctgcgcgtcgatggcggtgcttgcgcaaatgattttcttatgcaatttcaa
gccgatatactcggcatagaagtagaaagaccgcctattgtggaaaccaccgcgctggga
gcggcatatttagctggcttagaagtggggtactggaacaaagacgcgctaaatgcggta
tggatacccagcaaagtatttaaaccgcaaatgagcgatgagcaacgctttcaattaagc
caacgctggcatgaagcggtaaaaagggcattatcgtgggctaggtaa

DBGET integrated database retrieval system