KEGG   Mahella australiensis: Mahau_2529Help
Entry
Mahau_2529        CDS       T01494                                 

Definition
(GenBank) Ion transport 2 domain protein
  KO
K10716  
voltage-gated potassium channel
Organism
mas  Mahella australiensis
Brite
Transporters [BR:mas02000]
 Other Transporters
  Pores ion channels [TC:1]
   Mahau_2529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2657508..2658254
Genome map
AA seq 248 aa AA seqDB search
MDIIIIILAVVSVVMAIADLVGAAVTLKPWFYPLDSIILIFFAIDYFFRLFTAKDKKDFF
KRNIFDLIAIIPFGPLFSFFRVFRIFRLTKLVKLFKIVRFIGISGRFKQRIDAFLHTNGL
IYVIYINIACLLVGSIAIYITEKGLTVQSFGDAVWWAFVTTTTVGYGDISPKTGIGRIIA
AVLMMCGIGLISMLTGTIATYFTAIANQDAKTKKMDELKTIADILTAEQLDELINFANNI
SARDKIVQ
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggatataataatcattatattggctgttgtttctgttgttatggctattgctgattta
gttggggctgctgttactttaaaaccatggttttatcctttagattctattatattaata
ttttttgccatcgattatttctttcgtttatttaccgctaaagataaaaaggatttcttt
aagcgtaatatctttgatttaattgcaattattccattcgggccgttattttcgtttttc
cgtgtattccgcatattcagattgaccaaacttgttaagcttttcaaaatagttcgtttt
atcggcataagcggcagattcaaacaaagaatcgacgcttttttacataccaacggattg
atttatgttatttatattaatattgcgtgtctattagtcggatctatagcaatatatata
actgaaaaaggtcttactgtccaatcattcggagacgctgtgtggtgggcgtttgtaact
actactactgtaggctatggcgatatttctcctaaaacgggtataggccgaattattgct
gctgttcttatgatgtgcggtataggattaatttctatgcttacaggaactatcgctact
tattttacggccattgctaatcaggatgctaaaacaaaaaagatggatgaattaaaaact
attgctgatatcctcactgctgagcaacttgatgaattgataaactttgccaataatata
tctgcccgagataaaattgtgcagtaa

DBGET integrated database retrieval system