KEGG   Mahella australiensis: Mahau_2529Help
Entry
Mahau_2529        CDS       T01494                                 

Definition
Ion transport 2 domain-containing protein
Orthology
K10716  
voltage-gated potassium channel
Organism
mas  Mahella australiensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2657508..2658254
Genome map
AA seq 248 aa AA seqDB search
MDIIIIILAVVSVVMAIADLVGAAVTLKPWFYPLDSIILIFFAIDYFFRLFTAKDKKDFF
KRNIFDLIAIIPFGPLFSFFRVFRIFRLTKLVKLFKIVRFIGISGRFKQRIDAFLHTNGL
IYVIYINIACLLVGSIAIYITEKGLTVQSFGDAVWWAFVTTTTVGYGDISPKTGIGRIIA
AVLMMCGIGLISMLTGTIATYFTAIANQDAKTKKMDELKTIADILTAEQLDELINFANNI
SARDKIVQ
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggatataataatcattatattggctgttgtttctgttgttatggctattgctgattta
gttggggctgctgttactttaaaaccatggttttatcctttagattctattatattaata
ttttttgccatcgattatttctttcgtttatttaccgctaaagataaaaaggatttcttt
aagcgtaatatctttgatttaattgcaattattccattcgggccgttattttcgtttttc
cgtgtattccgcatattcagattgaccaaacttgttaagcttttcaaaatagttcgtttt
atcggcataagcggcagattcaaacaaagaatcgacgcttttttacataccaacggattg
atttatgttatttatattaatattgcgtgtctattagtcggatctatagcaatatatata
actgaaaaaggtcttactgtccaatcattcggagacgctgtgtggtgggcgtttgtaact
actactactgtaggctatggcgatatttctcctaaaacgggtataggccgaattattgct
gctgttcttatgatgtgcggtataggattaatttctatgcttacaggaactatcgctact
tattttacggccattgctaatcaggatgctaaaacaaaaaagatggatgaattaaaaact
attgctgatatcctcactgctgagcaacttgatgaattgataaactttgccaataatata
tctgcccgagataaaattgtgcagtaa

DBGET integrated database retrieval system