KEGG   Mahella australiensis: Mahau_2583Help
Entry
Mahau_2583        CDS       T01494                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mas  Mahella australiensis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:mas00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mas00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mas00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mas00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2717674..2718582)
Genome map
AA seq 302 aa AA seqDB search
MRVRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAIASGIEDIIIVTGRGK
RAIEDHFDKSVELEMELKRQGKEELLHLVEDISNMVDIHYIRQKEPRGLGHAIYCARSFI
GNEPFAVLLGDDVIDSKTPCLKQLIDVYNEYKTTVLGVQQVPWDKVNRYGILKYMQIEPG
IYKVKELVEKPSREQAPSNVAILGRYIITPQIFDILEHTQPGAGGEIQLTDALQELLKCE
AMYAYEFEGKRYDVGDKLGFLQATVEFALKREDIADDFRAYLHTLLEQETPQLAAAGDTK
TA
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcgagtcagaaaggctataataccagccgcgggattgggcacgcgatttttaccggcc
acaaaagctcagcctaaggaaatgctacctatagttgataagcctactattcaatatatt
gtagaagaagccatagcttccggcatagaggatataataatcgttaccggccgcggcaaa
cgggccatagaggaccattttgacaaatcggtagagcttgaaatggaactcaagcgtcag
ggcaaagaggaactgcttcatcttgtagaggatatatccaatatggttgatatacattat
atacggcaaaaagaaccgcgagggctgggacatgctatatactgtgcccgctcgtttata
ggcaatgagccgtttgcagtgctgctgggcgacgatgtcatagattccaagacgccgtgt
ttgaaacagctcatagacgtctacaacgagtataagacaacggtactgggcgtgcagcag
gtgccatgggataaagtgaacagatacggcatcttgaagtatatgcagatagagccgggt
atatataaggttaaagaactggtcgaaaaaccgtctcgcgagcaagcaccgtctaatgtg
gccatattgggccgatacattataacacctcagatattcgatatacttgagcatacacag
ccgggcgcgggcggcgagatacagcttaccgatgctctacaggaattgcttaaatgtgaa
gcgatgtatgcatacgaattcgaaggcaaacgttacgacgtgggcgataagctcggattc
ctgcaggctaccgtcgagtttgcgctaaagcgcgaggacatagccgatgatttcagagca
tatctgcacactttgctagaacaagaaaccccgcaattagcagcggctggtgatacaaag
acagcgtga

DBGET integrated database retrieval system