KEGG   Mahella australiensis: Mahau_2583Help
Entry
Mahau_2583        CDS       T01494                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mas  Mahella australiensis
Pathway
mas00040  Pentose and glucuronate interconversions
mas00052  Galactose metabolism
mas00500  Starch and sucrose metabolism
mas00520  Amino sugar and nucleotide sugar metabolism
mas01100  Metabolic pathways
mas01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mas00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mahau_2583
   00052 Galactose metabolism
    Mahau_2583
   00500 Starch and sucrose metabolism
    Mahau_2583
   00520 Amino sugar and nucleotide sugar metabolism
    Mahau_2583
Enzymes [BR:mas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Mahau_2583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AEE97728
UniProt: F3ZY32
Position
complement(2717674..2718582)
Genome map
AA seq 302 aa AA seqDB search
MRVRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAIASGIEDIIIVTGRGK
RAIEDHFDKSVELEMELKRQGKEELLHLVEDISNMVDIHYIRQKEPRGLGHAIYCARSFI
GNEPFAVLLGDDVIDSKTPCLKQLIDVYNEYKTTVLGVQQVPWDKVNRYGILKYMQIEPG
IYKVKELVEKPSREQAPSNVAILGRYIITPQIFDILEHTQPGAGGEIQLTDALQELLKCE
AMYAYEFEGKRYDVGDKLGFLQATVEFALKREDIADDFRAYLHTLLEQETPQLAAAGDTK
TA
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcgagtcagaaaggctataataccagccgcgggattgggcacgcgatttttaccggcc
acaaaagctcagcctaaggaaatgctacctatagttgataagcctactattcaatatatt
gtagaagaagccatagcttccggcatagaggatataataatcgttaccggccgcggcaaa
cgggccatagaggaccattttgacaaatcggtagagcttgaaatggaactcaagcgtcag
ggcaaagaggaactgcttcatcttgtagaggatatatccaatatggttgatatacattat
atacggcaaaaagaaccgcgagggctgggacatgctatatactgtgcccgctcgtttata
ggcaatgagccgtttgcagtgctgctgggcgacgatgtcatagattccaagacgccgtgt
ttgaaacagctcatagacgtctacaacgagtataagacaacggtactgggcgtgcagcag
gtgccatgggataaagtgaacagatacggcatcttgaagtatatgcagatagagccgggt
atatataaggttaaagaactggtcgaaaaaccgtctcgcgagcaagcaccgtctaatgtg
gccatattgggccgatacattataacacctcagatattcgatatacttgagcatacacag
ccgggcgcgggcggcgagatacagcttaccgatgctctacaggaattgcttaaatgtgaa
gcgatgtatgcatacgaattcgaaggcaaacgttacgacgtgggcgataagctcggattc
ctgcaggctaccgtcgagtttgcgctaaagcgcgaggacatagccgatgatttcagagca
tatctgcacactttgctagaacaagaaaccccgcaattagcagcggctggtgatacaaag
acagcgtga

DBGET integrated database retrieval system