KEGG   Mahella australiensis: Mahau_2786Help
Entry
Mahau_2786        CDS       T01494                                 

Definition
(RefSeq) iron-containing alcohol dehydrogenase
  KO
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
mas  Mahella australiensis
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mas00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Mahau_2786
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mahau_2786
  Lipid metabolism
   00071 Fatty acid degradation
    Mahau_2786
  Amino acid metabolism
   00350 Tyrosine metabolism
    Mahau_2786
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mahau_2786
   00626 Naphthalene degradation
    Mahau_2786
Enzymes [BR:mas01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Mahau_2786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2955377..2956561
Genome map
AA seq 394 aa AA seqDB search
MDVNMKFNMYIPTKILFGEGKLNELGSQKIPGRKALLVISSGKSVRENGALARTEEQLKV
AGVDYVLFDKIMQNPVKMTVMEGAALAKANGCDFVVALGGGSVMDSGKAIAMMVNNEGDL
WDYAGGKTGKRLPLKNPPVPLVCITTTAGTGSEVDAGGVITNEETNEKIGIAGYEESFPV
LSVVDPELMKTVPPKYTAYQGFDALLQSIECYISYFNNVMSDMYALTSIEYAGKYLPRAV
KDGNDREARSGMAFANTLSGVAMVLSSTTAEHSMEHAMSAYHPNLPHGAGLIMISRAFFE
FFIDKHVCDERFVRMAKALGMDGVKKPEDFITALVKLQEDCGVANLKMSDYGIKPSEFDE
LARNAREAMGPLFAGNPYPMSHEDCVEIYRKSYK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggatgtaaacatgaaattcaatatgtatatacctactaagattttattcggagaagga
aagctaaacgagttgggctcacaaaagatacccggcaggaaagcgctcctcgtgatatct
agtggcaaatcggtaagagaaaacggagctctcgcaaggacggaggagcagctaaaggtc
gctggtgtagattacgttttgtttgacaaaatcatgcaaaacccggttaagatgaccgtt
atggagggcgccgcgttggccaaagcgaacggctgcgactttgtagtagccttaggcggt
ggaagcgttatggattcaggcaaggccatagccatgatggttaacaacgagggcgacctt
tgggattatgccggtggtaagaccggcaagcggctgccgcttaagaatccgccggttccg
ctagtatgtatcacgacgactgccggcacgggcagcgaggtggatgccggcggggttata
accaacgaggaaaccaatgagaaaataggcattgccggttatgaagaatcattccccgta
ctgtccgtagtagaccccgagctcatgaaaaccgtacctccgaaatatacggcttatcaa
ggctttgatgccctgctgcaaagcatagaatgctatatctcttatttcaacaatgttatg
agcgatatgtatgctctgacatcgatagaatacgccggcaaatatctgccccgtgctgtg
aaagacggcaatgacagggaagcccgcagcggcatggcgttcgccaatacgctgtccggc
gttgcaatggtgctttcttccactaccgcagagcattctatggagcacgctatgtctgca
tatcatccaaatttgcctcatggcgccggcctcatcatgatatccagggcgttttttgaa
ttctttatagataagcacgtttgcgacgagcgctttgtccgcatggctaaggcattgggc
atggatggcgtgaaaaagccggaggatttcataacagcgctggtaaagctgcaggaggac
tgcggcgtagccaacctaaagatgtcggattacggcattaagccgtctgaatttgacgaa
ctggcgcgtaatgcccgtgaggcgatgggtccattgttcgcaggcaatccgtatcccatg
agccatgaggattgcgtggaaatatataggaaatcatataaataa

DBGET integrated database retrieval system