KEGG   Mycoplasma arthritidis: MARTH_orf160Help
Entry
MARTH_orf160      CDS       T00724                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mat  Mycoplasma arthritidis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mat00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MARTH_orf160 (recR)
DNA repair and recombination proteins [BR:mat03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      MARTH_orf160 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
153695..154285
Genome map
AA seq 196 aa AA seqDB search
MYDELLNKLTIKLKAIQGLNKKQITAIVEYILNAESGELDDIAMLIKTIKTTYKKCLFCN
NFSSQEKCEICSDSTRENKLMVVENAKTIKQFEVAQIYRGKYFILEALYNPKKPNLLFNK
NLEKLLLIATKANEVVLALSPTIEGAITMDYLKKSLRDANNMHNVYQLATGIPLGVNVEY
IDSETLKQSFLKKTKF
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgtatgatgaattattaaataaactaactattaagcttaaagcaatacaaggtttgaat
aaaaaacaaattacagcaattgttgaatatattcttaacgccgaaagtggcgagttagat
gatattgcaatgttaattaaaactattaaaacaacttataaaaaatgtttgttttgcaat
aattttagtagccaagaaaaatgtgaaatttgttcagattcaactcgcgaaaataaattg
atggtagtagaaaatgctaaaactatcaaacaatttgaagtggcccaaatctatcgtggt
aaatactttatcctagaagccctttacaatcccaaaaaaccaaatttgctatttaataaa
aacctagaaaaattgctactaatagcaacaaaagcaaatgaagtagttttggctcttagc
cccactattgaaggcgctattacgatggattatttaaaaaaatctttacgtgacgccaat
aatatgcacaatgtctatcaactagccactggcattccacttggagtaaatgttgagtat
attgatagtgaaacgttaaaacaatcatttcttaaaaaaactaaattttaa

DBGET integrated database retrieval system