KEGG   Mycoplasma arthritidis: MARTH_orf296Help
Entry
MARTH_orf296      CDS       T00724                                 

Gene name
hemK
Definition
protoporphyrinogen oxidase
Orthology
K02493  
release factor glutamine methyltransferase [EC:2.1.1.-]
Organism
mat  Mycoplasma arthritidis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
266201..266908
Genome map
AA seq 235 aa AA seqDB search
MIDKHILLREKERYNLPLEISNKELKLLKKDCPVQKIIGYQEMQNVFIDLSYKVLIPRYE
TEELIISSYQYLNKNSKVLDLGCGSGFIGLAIKKNIGCYVTLVDISKQAIKQSELNAKLN
NLDVKIIKSNWFSNVKNDERFDVIVSNPPYLNRKNHFAKSLSYEPKIALFAKKSGLFSYM
QILKKAKNYLNESGKLIFEIDQNSAIFLKQNYPKVIVKKDINGKDRIAILQKDDL
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgattgataaacacattttactaagggaaaaagaacgttacaatttacctttagagatt
tcaaataaagagctaaaactactaaaaaaagactgccctgtacaaaaaatcattggctat
caagaaatgcaaaatgtctttattgatttatcttacaaagtcttaattccgcgatacgaa
actgaagaactaataatatcttcataccaatatttaaataaaaattccaaagtactagat
ttaggttgtggctctggttttattggactggctattaaaaaaaatattggctgttatgtg
acacttgttgatatctctaagcaagcgattaagcaaagcgaattaaacgctaagttaaat
aacttggacgtcaaaataattaagtcaaattgatttagtaatgttaaaaatgatgaaaga
tttgatgtaattgtctctaatcccccttatcttaatagaaaaaatcattttgcaaaatca
ctttcatacgagcctaaaattgccctttttgccaaaaaaagtggattattttcttatatg
caaattttaaaaaaggctaagaactatttaaatgaaagtggtaaattaatttttgaaatt
gatcaaaatagtgctatttttctaaagcaaaattatcctaaagtaattgtgaaaaaggat
attaatggtaaggatcgcatcgcaattttgcaaaaggatgacttataa

DBGET integrated database retrieval system