KEGG   Mycoplasma arthritidis: MARTH_orf397Help
Entry
MARTH_orf397      CDS       T00724                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mat  Mycoplasma arthritidis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MARTH_orf397 (tpiA)
   01230 Biosynthesis of amino acids
    MARTH_orf397 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MARTH_orf397 (tpiA)
   00051 Fructose and mannose metabolism
    MARTH_orf397 (tpiA)
   00562 Inositol phosphate metabolism
    MARTH_orf397 (tpiA)
Enzymes [BR:mat01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MARTH_orf397 (tpiA)
Exosome [BR:mat04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MARTH_orf397 (tpiA)
  Exosomal proteins of bladder cancer cells
   MARTH_orf397 (tpiA)
  Exosomal proteins of melanoma cells
   MARTH_orf397 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(356569..357300)
Genome map
AA seq 243 aa AA seqDB search
MKYLLGNLKMNFTYQECEKYLDTLEKALSEANLKNVILGVAPSAEAMSLILKFKDRHFLF
GTQNIFYKDKGAYTGEVSIRSAKEFGLDFTLTGHSERRHTFGETNDLINKKIMAINQTTI
QPILCIGENLEEFNQKRTKDVLTEQITSALKNVDSNLDNLIISYEPVYSIGNGQVPENNY
IEQVVSLIKKITNNKYKVLYGGSVAPKNIEELNKIKNLDGYLVGSAALDAVAFVKMAQTM
DKQ
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatttattaggtaacttgaaaatgaacttcacatatcaagaatgtgaaaaatat
ctagacactttagaaaaagcattaagtgaagcaaacttaaaaaatgtaatcttaggtgta
gctcctagcgccgaagctatgtcacttattttgaagtttaaagatcgtcacttcttattt
ggaacacaaaatattttttataaagataaaggcgcttataccggcgaagtttcaataaga
tcagctaaagaatttggtttagattttactttgacagggcactcagaaagacgtcatact
tttggtgaaactaatgatttgattaataaaaagattatggcaattaatcaaactaccatt
caaccaattttgtgtatcggcgaaaacttagaagaatttaatcaaaaaagaactaaagat
gtgctaactgaacaaataacatcagcactaaaaaatgtggatagtaacttagataatcta
attatttcttatgagcctgtatattcaattggcaatgggcaagtaccagaaaataattac
attgaacaagttgttagcttaattaaaaaaattactaataataaatataaagttctttat
ggtggcagtgttgctcctaagaatattgaagagcttaataaaatcaagaatcttgatggt
tatttagtagggtcagccgcactagacgctgttgcttttgtaaagatggcacaaacaatg
gataaacaataa

DBGET integrated database retrieval system