KEGG   Mycoplasma arthritidis: MARTH_orf397Help
Entry
MARTH_orf397      CDS       T00724                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mat  Mycoplasma arthritidis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:mat01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mat01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mat00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mat00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(356569..357300)
Genome map
AA seq 243 aa AA seqDB search
MKYLLGNLKMNFTYQECEKYLDTLEKALSEANLKNVILGVAPSAEAMSLILKFKDRHFLF
GTQNIFYKDKGAYTGEVSIRSAKEFGLDFTLTGHSERRHTFGETNDLINKKIMAINQTTI
QPILCIGENLEEFNQKRTKDVLTEQITSALKNVDSNLDNLIISYEPVYSIGNGQVPENNY
IEQVVSLIKKITNNKYKVLYGGSVAPKNIEELNKIKNLDGYLVGSAALDAVAFVKMAQTM
DKQ
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatttattaggtaacttgaaaatgaacttcacatatcaagaatgtgaaaaatat
ctagacactttagaaaaagcattaagtgaagcaaacttaaaaaatgtaatcttaggtgta
gctcctagcgccgaagctatgtcacttattttgaagtttaaagatcgtcacttcttattt
ggaacacaaaatattttttataaagataaaggcgcttataccggcgaagtttcaataaga
tcagctaaagaatttggtttagattttactttgacagggcactcagaaagacgtcatact
tttggtgaaactaatgatttgattaataaaaagattatggcaattaatcaaactaccatt
caaccaattttgtgtatcggcgaaaacttagaagaatttaatcaaaaaagaactaaagat
gtgctaactgaacaaataacatcagcactaaaaaatgtggatagtaacttagataatcta
attatttcttatgagcctgtatattcaattggcaatgggcaagtaccagaaaataattac
attgaacaagttgttagcttaattaaaaaaattactaataataaatataaagttctttat
ggtggcagtgttgctcctaagaatattgaagagcttaataaaatcaagaatcttgatggt
tatttagtagggtcagccgcactagacgctgttgcttttgtaaagatggcacaaacaatg
gataaacaataa

DBGET integrated database retrieval system