KEGG   Mycoplasma arthritidis: MARTH_orf448Help
Entry
MARTH_orf448      CDS       T00724                                 

Gene name
xfp
Definition
putative phosphoketolase
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
mat  Mycoplasma arthritidis
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mat00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MARTH_orf448 (xfp)
Enzymes [BR:mat01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     MARTH_orf448 (xfp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
384420..386801
Genome map
AA seq 793 aa AA seqDB search
MKKTNYDSNEYFNLIDKWFRAANYLSVGQIYLRNNPLLKTKLVADDVKIYPIGHWGTIPG
QNFIYAHLNRVINKYDLEMFYIEGPGHGGQVMISNSYLDGSYTEIYPEITEDEAGLKTMF
KRFSFPGGTASHAAPETPGSIHEGGELGYALSHATGAILDNPNVIAATVIGDGEAETGPL
AAGWFSNSFINPVNDGAVLPIIHLNGAKISNPTILSRKSNQELENYFSGLGWEPLFVEGD
DPKLMHPLMAKKLDEAIEKIQMIQASARKHKASEATRPVWPMLIVRTPKGWTGPKDWNGE
VVEGSFRAHQVPIPVNALNMTHIDKLEAWLTSYHPEELFDKNGKILEEIRALAPKGLKRM
AVHPITNGGINPRTLKLSSWEKFATKFETPGQIKGQDMIELGKYFAEIITLNKDNFRIFG
PDETKSNRMNAVFNVTKRQWLEKIAPTYDEWMSPEGRVIDSQLSEHQAEGFLEGYVITGR
HGVFASYEAFLRVVDSMLTQHMKWMKKSLELPWRKDFPSLNVIATSTAFQQDHNGYTHQD
PGLLGHLADKRPELIREYLPADTNCLLATMEKALKDRNVINLIVASKQPREQFYSVEEAS
ELVQKGYKIINWASNVSKNEEPDVVFAAAGVEPNLEALAAISILNKEFPNLKIRFVNVLD
LLKLKSPKHDPRGISDEEFDQIFTKNKPIIFAFHGYEGLLRDIFFDRHNHNLITHGYREN
GDITTSFDIRQLSHMDRFHIAKDAAIAALGKDGEMFAKKMDSKLQEHTSYVREYGYDLPE
VVNWKWTNLKPIK
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaaacaaactacgattcaaacgaatattttaatttaattgacaaatgatttcgt
gctgctaattatttaagtgttggacaaatttatctacgtaataatccgcttttaaaaact
aagttagttgctgatgacgtaaaaatttatccaattgggcactgaggaactattcctgga
caaaatttcatctatgcccacttaaatagagtaattaataaatatgacctagaaatgttt
tacattgaaggaccaggacatggtggacaagtaatgatttctaattcatatttagatggc
tcatacaccgaaatttatcctgaaatcactgaagatgaagccggcctaaaaactatgttc
aaacgcttttcattccctgggggtacggctagtcacgccgctcctgaaactccaggatca
attcatgaaggtggcgaacttggatacgctcttagtcacgctactggtgcaattttagac
aatccaaatgtcattgctgctactgttatcggcgatggtgaagccgaaactggtccttta
gcggctggatgattctcaaattcatttattaatccagtaaatgacggtgctgttttacca
ataattcacttgaatggtgccaaaatttctaatccaacaattttaagtcgcaaaagtaat
caagaattagaaaattacttttcagggttgggctgagaaccattatttgttgagggcgat
gatcctaaactaatgcatccattaatggcgaaaaagcttgatgaagcaattgaaaaaatt
caaatgattcaagctagtgctagaaaacacaaagcttcagaagcgacccgccccgtatga
ccaatgttgattgtgcgtacccctaaaggatgaactggacctaaagactgaaatggtgaa
gttgttgaaggaagttttagagcccaccaagttcctataccagtaaatgctctaaatatg
acccatattgataaactagaagcttgactaacttcatatcacccagaagagttatttgat
aaaaatggcaaaattcttgaagagattcgtgctttagcacctaagggtctaaaaagaatg
gcggttcacccaatcactaatggtggaataaatcctcgcacgcttaagttaagtagctga
gaaaaatttgcaactaaatttgaaacaccaggacaaattaaagggcaagatatgatcgaa
cttggaaaatattttgctgaaattattactttaaataaagacaattttagaatcttcgga
ccagatgaaaccaaatcaaatcgaatgaatgcagtctttaatgttactaagcgtcaatga
ctagaaaaaattgctcctacttacgatgaatgaatgtcaccagaaggcagagtaattgat
tctcaattaagtgaacatcaagccgaaggtttcttagaaggttatgtaattaccggtaga
catggtgtttttgctagttacgaagcttttttaagagtcgtagactcgatgcttacccaa
cacatgaaatgaatgaaaaaatcacttgaacttccttgaagaaaagattttccatcatta
aatgttattgctacttcaactgcctttcaacaagatcataacggttacactcaccaagat
cccggacttctagggcacttagccgataaacgtcctgaactaattcgcgaatatctacca
gctgatactaattgtttattagcaactatggaaaaagccttaaaagaccgcaacgttatt
aatctaattgtcgcttctaagcaaccacgtgaacaattctattcagttgaagaagcaagc
gaacttgtacaaaaaggctacaaaattattaattgagcatcaaatgtttcaaaaaatgaa
gaacccgatgttgtcttcgccgccgctggggttgaacctaacctggaagctttagcagca
atttcaattcttaacaaggaatttcctaacctaaaaattcgatttgttaatgtgcttgat
ttattaaaactaaaaagtccaaaacacgaccctcggggcattagtgacgaagaatttgat
caaattttcactaaaaataaaccaattatttttgcatttcatggttatgaagggttgttg
cgtgacattttctttgatcgtcacaaccataatttaattacacatggttatcgtgaaaat
ggcgacatcactactagttttgacatccgtcaactaagtcatatggatcgtttccatatc
gctaaagacgccgcaatagcagcacttggcaaagatggcgaaatgtttgcaaaaaaaatg
gacagtaaactgcaagaacacactagttatgttcgtgaatatggctacgatcttccagag
gttgtcaattgaaaatgaacaaacctaaaaccaattaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system