KEGG   Mycoplasma arthritidis: MARTH_orf738Help
Entry
MARTH_orf738      CDS       T00724                                 

Gene name
adhA
Definition
(GenBank) Zn-dependent alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mat  Mycoplasma arthritidis
Pathway
mat00010  Glycolysis / Gluconeogenesis
mat00625  Chloroalkane and chloroalkene degradation
mat00626  Naphthalene degradation
mat01100  Metabolic pathways
mat01110  Biosynthesis of secondary metabolites
mat01120  Microbial metabolism in diverse environments
mat01130  Biosynthesis of antibiotics
mat01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mat00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MARTH_orf738 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    MARTH_orf738 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    MARTH_orf738 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MARTH_orf738 (adhA)
   00626 Naphthalene degradation
    MARTH_orf738 (adhA)
Enzymes [BR:mat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MARTH_orf738 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C UDPG_MGDP_dh_N TrkA_N NAD_binding_2 3HCDH_N IGFBP Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: ACF07491
UniProt: B3PN89
Position
complement(685418..686470)
Genome map
AA seq 350 aa AA seqDB search
MAKMKAFVVESPKNWQIKEVNIPSPKYKEVLIKMETSGICHTDLHVANDDWLLKAKFPII
PGHEGIGIIVELGEGCNRFKVGDRVALAWLHDSCGHCEFCLQGKETLCPNQNMSAYTKDG
SFAEYAIGHEDYIAAIPNNFDIVQGAPIVCAGVTTYKAVKKANQKAGNWITVIGVGGLGH
LAIQYAKAMGYRVIGIDINDEKCDLAIKSGAEAAFNSLKSNVIDEVIKLTNGGSHAVINT
SVATKAAELGLSILRRGGRQVLVGLPSKNASGKDNFEVSIFWSVLYEKEIVGSIVGTRLD
LQEAIEFASLGKVKTEITRVVKLEDVPEIFKKLESGDFIGRAVIDFRTKK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaatgaaggcatttgtggttgaaagtccaaaaaattgacaaattaaggaagtg
aatattcctagtcctaagtataaagaagttcttattaaaatggaaacttcaggcatctgc
cacactgatttacatgtggcaaatgatgattgattattaaaagcaaaatttccaattatc
cctggtcatgaaggaataggcattattgttgaattaggcgagggatgcaatcgtttcaaa
gttggtgatcgcgtagcattggcttgattgcacgatagttgtggacattgtgaattttgt
ttacaaggtaaagaaactttgtgtccaaatcaaaatatgtcagcttatactaaagatgga
agttttgctgaatatgcaattgggcatgaagattacattgctgcgattcctaataatttt
gacattgttcaaggtgctccgattgtatgtgcaggtgtgacaacttacaaagcagttaaa
aaagcaaaccaaaaagctggaaattgaattacagtgattggtgttggcggactgggtcac
cttgctattcaatacgctaaagcaatggggtatcgtgtaattggaattgatatcaatgac
gaaaaatgcgatttagcaattaagtcaggagcagaagccgcttttaattcattgaaaagt
aacgtaattgatgaagtaattaaattaactaacggtggcagccacgctgttattaatact
tcggttgcaactaaagcggctgaattagggcttagcattcttcgtagaggtggaagacaa
gtattagttggtcttccctcaaaaaatgcttctggcaaagacaattttgaagtttcaatt
ttttgaagtgtattgtatgaaaaagaaattgttggttcaattgttggcactcgtttagat
ttgcaagaagcaatcgaatttgctagtttaggcaaagtgaaaaccgagattactagggtt
gtaaaattagaagatgttcctgaaatttttaaaaagcttgaaagtggcgattttatagga
agagcagtaattgattttcgtaccaaaaaataa

DBGET integrated database retrieval system