KEGG   Micromonospora aurantiaca: Micau_0428Help
Entry
Micau_0428        CDS       T01296                                 

Definition
acetate/CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mau  Micromonospora aurantiaca
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Micau_0428
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Micau_0428
   00620 Pyruvate metabolism
    Micau_0428
   00640 Propanoate metabolism
    Micau_0428
  Energy metabolism
   00680 Methane metabolism
    Micau_0428
Enzymes [BR:mau01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Micau_0428
Lipid biosynthesis proteins [BR:mau01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Micau_0428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(433823..435811)
Genome map
AA seq 662 aa AA seqDB search
MSEALANLLNETRQFPPPAELAANANVTAEAYEEAAGDRLAFWERQAGRLAWAQPWEQVL
DWSNAPFAKWFTGGKLNVAYNCLDRHVEAGLGDKVAIHWEGEPGDTRTVTYADLHKLTCQ
AANALTELGVTAGDRVAIYLPMIPEAAVAMLACARIGATHSVVFGGFSADALTNRIQDAS
AKVVITADGGFRRGKPSALKPTVDEAVANCPSVEHVLVVRRTGEEVAWSAKDHWWHETVE
TASPEHEAQAFDAEHPLFILYTSGTTARPKGILHTTGGYLTQTSYTTHAVFDLKPETDVY
WCTADIGWVTGHSYIVYGPLSNGATQVMYEGTPDTPHKGRFWEVVDKYKVTILYTAPTLI
RTMMKWGEDIPAGYDLSSLRLLGSVGEPINPEAWIWYRQHVGRGELPVVDTWWQTETGAI
MISPLPGVTEAKPGSAMSPLPGIVADVVDDQGQSVPNGGGGYLVLKEPWPSMLRTIWGDD
NRFLETYWSRFGAGANTGDEWVYFAGDGAKKDDDGHIWLLGRVDDVMLVSGHNISTTEVE
SALVSHPSVAEAAVVGATDPTTGQAIVAFAIPRGSAEISGDAGEQLIAELRNHVAKTLGP
IAKPRQIMLVPELPKTRSGKIMRRLLRDVAENRSLGDVTTLQDSSVMELISSGMSGGKSD
ED
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaggcattggccaacttgctgaacgagacgcgccagttcccgccgccggctgaa
ctcgccgcgaacgccaacgtgaccgccgaggcgtacgaggaggcggccggggaccggctg
gccttctgggagcgccaggccggccggctggcctgggcccagccgtgggagcaggtgctc
gactggtcgaacgccccgttcgcgaagtggttcaccgggggcaagctcaacgtggcgtac
aactgcctggaccggcacgtcgaggcgggcctcggcgacaaggtggcgatccactgggag
ggcgagccgggcgacacccgtaccgtcacctacgccgacctgcacaagctcacctgtcag
gcggcgaacgcgctgaccgagctgggcgtgaccgccggtgaccgggtggcgatctacctg
ccgatgatcccggaggcggcggtggcgatgctcgcctgcgcccggatcggcgccacgcac
agcgtggtgttcggcggcttctccgccgacgcgctcaccaaccggatccaggacgccagc
gccaaggtggtgatcaccgcggacggcggcttccgccggggcaagccgtcggcgctcaag
ccgacggtggacgaggcggtggcgaactgcccgtcggtcgagcacgtgctggtggtccgg
cgtaccggtgaggaggtcgcctggtcggcgaaggaccactggtggcacgagacggtggag
acggcgtcgccggagcacgaggcgcaggcgttcgacgccgagcacccgctgttcatcctc
tacaccagcggcacgaccgcccgcccgaagggcatcctgcacaccaccggcggctacctg
acccagacgtcgtacaccacgcacgcggtgttcgacctgaagccggagacggacgtctac
tggtgcacggccgacatcggctgggtgaccgggcactcctacatcgtgtacggcccgctc
tccaacggcgccacccaggtcatgtacgagggcacgccggacaccccgcacaagggccgg
ttctgggaggtcgtcgacaagtacaaggtgaccatcctgtacaccgcgccgacgctgatc
cgcaccatgatgaagtggggcgaggacatcccggccgggtacgacctgtcgtcgctgcgc
ctgctcggcagcgtcggtgagccgatcaacccggaggcgtggatctggtaccggcagcac
gtcggccgcggcgagctgccggtggtggacacctggtggcagaccgagaccggcgccatc
atgatctcgccgctgcccggcgtgaccgaggcgaagcccggctcggcgatgagcccgctg
cccggcatcgtcgccgacgtggtcgacgaccagggccagtcggtgccgaacggcggcggc
ggatacctcgtgctgaaggagccgtggccgtcgatgctgcggacgatctggggcgacgac
aaccggttcctggagacgtactggtcccggttcggcgccggtgcgaacaccggggacgag
tgggtctacttcgccggtgacggcgcgaagaaggacgacgacgggcacatctggctgctc
ggccgggtggacgacgtgatgctggtgtccggccacaacatctccaccacggaggtggag
tcggcgctggtcagccacccgtcggtggcggaggcggcggtggtgggcgcgaccgacccg
accaccggccaggcgattgtcgcgttcgccatcccgcgcggcagcgcggagatctccggt
gacgcgggcgaacagctcatcgccgagctgcgcaaccacgtggcgaagacgctcggcccg
atcgccaagccgcggcagatcatgctggtgccggagctgccgaagacccgctccggcaag
atcatgcgccggctgctgcgggacgtggcggagaaccggtcgctcggcgacgtgaccacg
ctccaggactcctcggtcatggaattgatctcgtcggggatgagcggcgggaagtccgac
gaggactga

DBGET integrated database retrieval system