KEGG   Micromonospora aurantiaca: Micau_0428Help
Entry
Micau_0428        CDS       T01296                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mau  Micromonospora aurantiaca
Pathway
mau00010  Glycolysis / Gluconeogenesis
mau00620  Pyruvate metabolism
mau00640  Propanoate metabolism
mau00680  Methane metabolism
mau01100  Metabolic pathways
mau01110  Biosynthesis of secondary metabolites
mau01120  Microbial metabolism in diverse environments
mau01130  Biosynthesis of antibiotics
mau01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Micau_0428
   00620 Pyruvate metabolism
    Micau_0428
   00640 Propanoate metabolism
    Micau_0428
  Energy metabolism
   00680 Methane metabolism
    Micau_0428
Enzymes [BR:mau01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Micau_0428
Lipid biosynthesis proteins [BR:mau01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Micau_0428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N MlrC_C
Motif
Other DBs
NCBI-ProteinID: ADL43995
JGI: Micau_0428
UniProt: D9T6P9
Position
complement(433823..435811)
Genome map
AA seq 662 aa AA seqDB search
MSEALANLLNETRQFPPPAELAANANVTAEAYEEAAGDRLAFWERQAGRLAWAQPWEQVL
DWSNAPFAKWFTGGKLNVAYNCLDRHVEAGLGDKVAIHWEGEPGDTRTVTYADLHKLTCQ
AANALTELGVTAGDRVAIYLPMIPEAAVAMLACARIGATHSVVFGGFSADALTNRIQDAS
AKVVITADGGFRRGKPSALKPTVDEAVANCPSVEHVLVVRRTGEEVAWSAKDHWWHETVE
TASPEHEAQAFDAEHPLFILYTSGTTARPKGILHTTGGYLTQTSYTTHAVFDLKPETDVY
WCTADIGWVTGHSYIVYGPLSNGATQVMYEGTPDTPHKGRFWEVVDKYKVTILYTAPTLI
RTMMKWGEDIPAGYDLSSLRLLGSVGEPINPEAWIWYRQHVGRGELPVVDTWWQTETGAI
MISPLPGVTEAKPGSAMSPLPGIVADVVDDQGQSVPNGGGGYLVLKEPWPSMLRTIWGDD
NRFLETYWSRFGAGANTGDEWVYFAGDGAKKDDDGHIWLLGRVDDVMLVSGHNISTTEVE
SALVSHPSVAEAAVVGATDPTTGQAIVAFAIPRGSAEISGDAGEQLIAELRNHVAKTLGP
IAKPRQIMLVPELPKTRSGKIMRRLLRDVAENRSLGDVTTLQDSSVMELISSGMSGGKSD
ED
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaggcattggccaacttgctgaacgagacgcgccagttcccgccgccggctgaa
ctcgccgcgaacgccaacgtgaccgccgaggcgtacgaggaggcggccggggaccggctg
gccttctgggagcgccaggccggccggctggcctgggcccagccgtgggagcaggtgctc
gactggtcgaacgccccgttcgcgaagtggttcaccgggggcaagctcaacgtggcgtac
aactgcctggaccggcacgtcgaggcgggcctcggcgacaaggtggcgatccactgggag
ggcgagccgggcgacacccgtaccgtcacctacgccgacctgcacaagctcacctgtcag
gcggcgaacgcgctgaccgagctgggcgtgaccgccggtgaccgggtggcgatctacctg
ccgatgatcccggaggcggcggtggcgatgctcgcctgcgcccggatcggcgccacgcac
agcgtggtgttcggcggcttctccgccgacgcgctcaccaaccggatccaggacgccagc
gccaaggtggtgatcaccgcggacggcggcttccgccggggcaagccgtcggcgctcaag
ccgacggtggacgaggcggtggcgaactgcccgtcggtcgagcacgtgctggtggtccgg
cgtaccggtgaggaggtcgcctggtcggcgaaggaccactggtggcacgagacggtggag
acggcgtcgccggagcacgaggcgcaggcgttcgacgccgagcacccgctgttcatcctc
tacaccagcggcacgaccgcccgcccgaagggcatcctgcacaccaccggcggctacctg
acccagacgtcgtacaccacgcacgcggtgttcgacctgaagccggagacggacgtctac
tggtgcacggccgacatcggctgggtgaccgggcactcctacatcgtgtacggcccgctc
tccaacggcgccacccaggtcatgtacgagggcacgccggacaccccgcacaagggccgg
ttctgggaggtcgtcgacaagtacaaggtgaccatcctgtacaccgcgccgacgctgatc
cgcaccatgatgaagtggggcgaggacatcccggccgggtacgacctgtcgtcgctgcgc
ctgctcggcagcgtcggtgagccgatcaacccggaggcgtggatctggtaccggcagcac
gtcggccgcggcgagctgccggtggtggacacctggtggcagaccgagaccggcgccatc
atgatctcgccgctgcccggcgtgaccgaggcgaagcccggctcggcgatgagcccgctg
cccggcatcgtcgccgacgtggtcgacgaccagggccagtcggtgccgaacggcggcggc
ggatacctcgtgctgaaggagccgtggccgtcgatgctgcggacgatctggggcgacgac
aaccggttcctggagacgtactggtcccggttcggcgccggtgcgaacaccggggacgag
tgggtctacttcgccggtgacggcgcgaagaaggacgacgacgggcacatctggctgctc
ggccgggtggacgacgtgatgctggtgtccggccacaacatctccaccacggaggtggag
tcggcgctggtcagccacccgtcggtggcggaggcggcggtggtgggcgcgaccgacccg
accaccggccaggcgattgtcgcgttcgccatcccgcgcggcagcgcggagatctccggt
gacgcgggcgaacagctcatcgccgagctgcgcaaccacgtggcgaagacgctcggcccg
atcgccaagccgcggcagatcatgctggtgccggagctgccgaagacccgctccggcaag
atcatgcgccggctgctgcgggacgtggcggagaaccggtcgctcggcgacgtgaccacg
ctccaggactcctcggtcatggaattgatctcgtcggggatgagcggcgggaagtccgac
gaggactga

DBGET integrated database retrieval system