KEGG   Micromonospora aurantiaca: Micau_0478Help
Entry
Micau_0478        CDS       T01296                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
mau  Micromonospora aurantiaca
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:mau01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:mau00680]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:mau00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(487860..488984)
Genome map
AA seq 374 aa AA seqDB search
MYEGPHEVAVNEVDDPRIEDPNDVVVQVTTTAICGSDLHMYEGRTAAEPGIVFGHENMGV
IVETGPGVTSLRVGDRVSMPFNVACGFCRNCREQRTGFCLTVNPGFAGGAYGYVSMGPYR
GGQAEYLRVPFADFNCLKLPPGTEHENDYAMLADIFPTGYHGVAMTGLRPGENLTVMGGG
PVGLMAAYSAVLIGASEVFVVDRVPDRLRLAESIGATAIDFSAGDPVEQIRDRTDGVGTD
HGVDAVGYQASAPSGEEQPALVLNTLVEVVRATGAIGVVGLYLSADPGAPDEHSARGELL
FKVGKLFEKGLRIGTGQANVKTYNAYLRNLITAGRATPSFVVSKELPLDAAPEAYQRFDR
REPGYSKVVLKPAA
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
gtgtacgaggggccgcacgaggtggccgtcaacgaggtcgacgacccccggatcgaggat
ccgaacgacgtggtcgtccaggtcacgacgaccgcgatctgcggttcggacctgcacatg
tacgagggacggacggccgccgagccgggcatcgtgttcggccacgagaacatgggcgtg
atcgtcgagaccgggccgggcgtgacgagcctgcgcgtgggcgaccgggtctcgatgccg
ttcaacgtggcgtgcgggttctgccgcaactgccgggagcagcgcaccggtttctgcctg
acggtgaacccgggcttcgccggcggcgcgtacggctacgtgtcgatggggccgtaccgg
ggtgggcaggccgagtacctgcgggtgccgttcgccgacttcaactgcctgaagctgccg
ccgggcaccgaacacgagaacgactacgcgatgctcgccgacatcttcccgaccggctac
cacggtgtggcgatgaccgggctgcggccgggcgagaacctgacagtgatgggcggcggg
ccggtcgggctgatggccgcgtactcggcggtgctgatcggggcgtccgaggtgttcgtg
gtggaccgggtgccggaccggctgcggctggccgagtcgatcggcgccacagcgatcgac
ttcagcgcgggcgacccggtcgagcagatccgggaccggaccgacggggtggggaccgat
cacggcgtggacgcggtgggataccaggcgtccgcgcccagcggcgaggagcagccggcg
ctggtgctgaacacgctcgtggaggtggtgcgcgcgaccggggcgatcggcgtggtcggg
ctctacctctcggcggacccgggcgccccggacgagcactccgcccggggtgagctgctg
ttcaaggtgggcaagctgttcgagaagggcctgcggatcggcaccgggcaggcgaacgtg
aagacgtacaacgcgtacctgcggaacctgatcacggcggggcgggcgacgccgagcttc
gtggtgagcaaggaactgccgctggacgcggcgccggaggcgtaccagcgcttcgaccgc
cgcgaaccgggctactcgaaggtcgtgctcaagccggccgcctga

DBGET integrated database retrieval system