KEGG   Micromonospora aurantiaca: Micau_0478Help
Entry
Micau_0478        CDS       T01296                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
mau  Micromonospora aurantiaca
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Micau_0478
  Energy metabolism
   00680 Methane metabolism
    Micau_0478
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Micau_0478
Enzymes [BR:mau01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     Micau_0478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(487860..488984)
Genome map
AA seq 374 aa AA seqDB search
MYEGPHEVAVNEVDDPRIEDPNDVVVQVTTTAICGSDLHMYEGRTAAEPGIVFGHENMGV
IVETGPGVTSLRVGDRVSMPFNVACGFCRNCREQRTGFCLTVNPGFAGGAYGYVSMGPYR
GGQAEYLRVPFADFNCLKLPPGTEHENDYAMLADIFPTGYHGVAMTGLRPGENLTVMGGG
PVGLMAAYSAVLIGASEVFVVDRVPDRLRLAESIGATAIDFSAGDPVEQIRDRTDGVGTD
HGVDAVGYQASAPSGEEQPALVLNTLVEVVRATGAIGVVGLYLSADPGAPDEHSARGELL
FKVGKLFEKGLRIGTGQANVKTYNAYLRNLITAGRATPSFVVSKELPLDAAPEAYQRFDR
REPGYSKVVLKPAA
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
gtgtacgaggggccgcacgaggtggccgtcaacgaggtcgacgacccccggatcgaggat
ccgaacgacgtggtcgtccaggtcacgacgaccgcgatctgcggttcggacctgcacatg
tacgagggacggacggccgccgagccgggcatcgtgttcggccacgagaacatgggcgtg
atcgtcgagaccgggccgggcgtgacgagcctgcgcgtgggcgaccgggtctcgatgccg
ttcaacgtggcgtgcgggttctgccgcaactgccgggagcagcgcaccggtttctgcctg
acggtgaacccgggcttcgccggcggcgcgtacggctacgtgtcgatggggccgtaccgg
ggtgggcaggccgagtacctgcgggtgccgttcgccgacttcaactgcctgaagctgccg
ccgggcaccgaacacgagaacgactacgcgatgctcgccgacatcttcccgaccggctac
cacggtgtggcgatgaccgggctgcggccgggcgagaacctgacagtgatgggcggcggg
ccggtcgggctgatggccgcgtactcggcggtgctgatcggggcgtccgaggtgttcgtg
gtggaccgggtgccggaccggctgcggctggccgagtcgatcggcgccacagcgatcgac
ttcagcgcgggcgacccggtcgagcagatccgggaccggaccgacggggtggggaccgat
cacggcgtggacgcggtgggataccaggcgtccgcgcccagcggcgaggagcagccggcg
ctggtgctgaacacgctcgtggaggtggtgcgcgcgaccggggcgatcggcgtggtcggg
ctctacctctcggcggacccgggcgccccggacgagcactccgcccggggtgagctgctg
ttcaaggtgggcaagctgttcgagaagggcctgcggatcggcaccgggcaggcgaacgtg
aagacgtacaacgcgtacctgcggaacctgatcacggcggggcgggcgacgccgagcttc
gtggtgagcaaggaactgccgctggacgcggcgccggaggcgtaccagcgcttcgaccgc
cgcgaaccgggctactcgaaggtcgtgctcaagccggccgcctga

DBGET integrated database retrieval system