KEGG   Micromonospora aurantiaca: Micau_0620Help
Entry
Micau_0620        CDS       T01296                                 

Definition
1,4-beta cellobiohydrolase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mau  Micromonospora aurantiaca
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mau00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
621062..622447
Genome map
AA seq 461 aa AA seqDB search
MAILSSRRRSAAISVAAVAGLAAAGVGFAVGGASAGTVSGSLYRDPSSAVVRWVAANPGD
SRAAVIRDKIASQPQARWYANFNPSTIQSEVSSFIGAANAAQQIPVLSVYEITNRDCGGA
SAGGAPDLNQYQTWVSNFARGLGNQTVLIILETDSLALQTCLSTGELNARNQALTTATQT
IKSANPNAKVYLDGGHSTWNSANDTANRLRAAGVQYADGFFTNVSNFNPTSSEANFGRAV
ISALNGMGISGKRQVIDTSRNGGAAGDWCADDNTDRRIGQYPTTNTGDANIDAYLWVKPP
GEADGCRYTAGSFQPDLAFSLANGAPNPPTTAPPTTNPPTTAPPTTAPPTTAPPTTAPPT
TPPPAGNGCSAAVAINQWNGGFTASVNVTAGSAAINGWTVTVALPGGAAITGTWNAQASG
TSGTVRFTNVGYNGQVGAGQTTNFGFQGTGTGQGATATCAA
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
gtggctatcctctcgtcccgccgcagatcagcggccatcagcgtggccgccgtcgcgggc
ctcgccgcggccggcgtcggtttcgccgtcggtggcgcatccgccggcacggtgtccgga
tcgctctaccgcgacccgtcctcggcggtcgtccgctgggtcgccgccaaccccggcgac
tcgcgcgccgccgtcatccgcgacaagatcgccagccagccgcaggcgcgctggtacgcc
aacttcaacccgtcgaccatccagtccgaggtttccagcttcatcggcgccgccaacgcg
gcgcagcagatcccggtgctgtcggtgtacgagatcaccaaccgggactgcggcggcgcc
agcgccggcggggcgccggacctcaaccagtaccagacctgggtgtccaacttcgcccgc
ggactcggcaaccagaccgtcctgatcatcctggagaccgactcgctcgcgctccagacc
tgcctgagcaccggcgagctgaacgcccgcaaccaggcgctcaccacggccacccagacc
atcaagtcggccaaccccaacgccaaggtgtacctcgacggcggccactcgacctggaac
agcgccaacgacactgccaaccggctccgcgcggccggcgtgcagtacgccgacggcttc
ttcaccaacgtgtcgaacttcaaccccacctccagtgaggcgaacttcggccgggccgtc
atctccgcgctcaacggcatgggcatctccggcaagcggcaggtcatcgacaccagccgc
aacgggggagccgccggggactggtgcgccgacgacaacaccgaccggcgcatcgggcag
tacccgacgacgaacaccggcgacgccaacatcgacgcgtacctctgggtgaagccgccg
ggtgaggcggacggctgccgctacacggccggttcgttccagccggacctggccttcagc
ctcgcgaatggcgcgccgaacccgccgaccaccgcgccgccgacgaccaacccgccgacg
accgcgccgccgaccacggctccgccgacgaccgcgccgcccaccacggcgccgccgacc
accccgccgccggccggtaacggctgctccgcggcggtcgcgatcaaccagtggaacggc
ggcttcaccgcgagcgtgaacgtcactgcgggctccgcggccatcaacggctggaccgtg
accgtcgcgctgcccggcggcgccgcgatcaccggcacctggaacgcccaggccagcggc
accagcggcaccgtccggttcacgaacgtgggctacaacgggcaggtcggcgccggccag
acgaccaacttcggcttccagggcaccggcaccggccagggcgccaccgccacctgcgcc
gcctga

DBGET integrated database retrieval system