KEGG   Micromonospora aurantiaca: Micau_0710Help
Entry
Micau_0710        CDS       T01296                                 

Definition
nucleotidyl transferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mau  Micromonospora aurantiaca
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Micau_0710
   00052 Galactose metabolism
    Micau_0710
   00500 Starch and sucrose metabolism
    Micau_0710
   00520 Amino sugar and nucleotide sugar metabolism
    Micau_0710
Enzymes [BR:mau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Micau_0710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
698077..699066
Genome map
AA seq 329 aa AA seqDB search
MSEHSANPSAAPGRSRAVKAVIPAAGLATRFLPATKAVPKELLPVVDRPVLQYIVEEAAQ
AGIDDILLITGRGKTSMVDHFDRRPDLEERLAKKPELLAEVKRTEELAAIYTVRQPEQLG
LGHAVGYAESHVGDAPFAVLLGDEFVKPSEPLLPAMLELQARTGGVVLAFFEVDPAETSR
YGIASVEPAESEYSDIAEVVKVTGMVEKPSPEDAPSNLAVLGRYVLPGKIFDAIRRTRPG
SGGEIQLTDAMELLRTEGVPVHAIVYRGTRYDTGMPLGYLQTVVQIAAEREDLGAEFRKW
LTEFVNNGDETVTAAVLNGIRDASGGADT
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagcactcagcgaacccctcagcggcccccggtcgctcccgcgcggtcaaggcc
gtgatcccggccgccggcctggccacccggttcctgccggccaccaaggcggttcccaag
gaactgctgccggtcgtcgaccggccggtgctgcagtacatcgtcgaggaggccgcccag
gccggcatcgacgacatcctgctgatcaccggtcgcggcaagacctcgatggtggaccac
ttcgaccgccggccggacctggaggaacggctcgccaagaagcccgagctgctggccgag
gtcaagcgcaccgaggaactcgcagcgatctacacggtccgccagccggaacagctcggc
ctcggtcacgccgtcgggtacgccgagtcgcacgtcggcgacgcgcccttcgcggtgctg
ctcggcgacgagttcgtcaagccctccgagccgctgctgccggccatgctggaactccag
gcccgcaccggcggcgtggtgctcgcgttcttcgaggtcgacccggccgagaccagccgc
tacggcatcgcgtcggtcgagccggccgagtcggaatactccgacatcgccgaggtcgtc
aaggtcaccggcatggtggagaagcccagcccggaggacgcccccagcaacctcgccgtc
ctcggccggtacgtgctccccgggaagatcttcgacgcgatccggcgtacccggccgggc
agcggcggcgagatccagctgaccgacgcgatggagctgctgcgtaccgagggggtgccg
gtgcacgccatcgtctaccggggcacccgctacgacaccggcatgccgctcggctacctc
cagaccgtggtgcagatcgccgccgagcgggaggacctgggcgccgagttccgcaagtgg
ctgaccgagttcgtcaacaacggtgacgagacggtcaccgccgcggtcctcaacggcatc
cgcgacgcgtccggcggtgccgatacatga

DBGET integrated database retrieval system