KEGG   Micromonospora aurantiaca: Micau_0745Help
Entry
Micau_0745        CDS       T01296                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mau  Micromonospora aurantiaca
Pathway
mau00900  Terpenoid backbone biosynthesis
mau01100  Metabolic pathways
mau01110  Biosynthesis of secondary metabolites
mau01130  Biosynthesis of antibiotics
Module
mau_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Micau_0745
Enzymes [BR:mau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Micau_0745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ADL44309
JGI: Micau_0745
UniProt: D9T9U3
Position
731542..732495
Genome map
AA seq 317 aa AA seqDB search
MTEAWRPGDEDGQRRGASGPVKVRVPAKVNLHLGVGPLRRDGYHELNTVYHAISIYDELT
ARRGDTLTLTMEGEGAGELALDDTNLALRAAHALAGYAGVAPHARLHLRKQIPLAGGLAG
GSADAAAALVACDTLWGTGLSRDELAGIAADLGSDVPFLIHGGTALGTGRGEAVSPVLAR
PTSWHWVVAIADAGLSTPAAYRELDRLRDAGAAGTPLGSTDALLAALRQRDPRVLAATLG
NDLQDAALTMRPSLAETLKAGEAAGALAGIVSGSGPTCVFLATGEADAVRIAAEITAAGV
CREARVAHGPVAGARVV
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaggcatggcgaccgggggacgaggacgggcagcggcgcggggccagcggcccg
gtcaaggtgcgggtgcccgccaaggtcaacctgcatctcggggtcggaccgctgcggcgt
gacggctaccacgagctgaacaccgtctaccacgcgatctcgatctacgacgagctgacc
gcccgtcgcggcgacacgctcaccctcaccatggagggcgagggcgccggcgagctggcg
ctggacgacaccaacctggcgctgcgcgccgcgcacgcgctggccggttacgcgggcgtc
gccccgcacgcccggctgcacctgcgcaagcagatcccgctcgccggcgggctggccggt
ggcagcgccgacgccgccgccgcgctcgtcgcctgcgacacgctctggggcaccgggctg
tcccgcgacgagctcgccggcatcgccgccgacctcggctcggacgtcccgttcctcatc
cacggcggcaccgcgctcggcaccggccgcggcgaggcggtcagcccggtgctggcccgc
cccacctcctggcactgggtggtggcgatcgccgacgccggcctgtccaccccggccgcg
taccgggaactggaccggctgcgtgacgccggagccgccggcacgccgctgggcagcacc
gacgcgctgctcgccgcgctgcgccagcgcgacccgcgggtgctcgccgccacgctcggc
aacgacctccaggacgccgcgctgaccatgcgcccctcgctggccgagacgctcaaggcc
ggcgaggccgcgggggcgctcgccggcatcgtctccggctccggacccacctgcgtcttc
ctcgccaccggcgaggccgacgccgtccggatcgccgccgagatcaccgccgccggggtg
tgccgggaggcccgcgtcgcgcacggtccggtcgccggcgcccgcgtggtctga

DBGET integrated database retrieval system