KEGG   Micromonospora aurantiaca: Micau_0745Help
Entry
Micau_0745        CDS       T01296                                 

Definition
4-diphosphocytidyl-2C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mau  Micromonospora aurantiaca
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:mau00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
731542..732495
Genome map
AA seq 317 aa AA seqDB search
MTEAWRPGDEDGQRRGASGPVKVRVPAKVNLHLGVGPLRRDGYHELNTVYHAISIYDELT
ARRGDTLTLTMEGEGAGELALDDTNLALRAAHALAGYAGVAPHARLHLRKQIPLAGGLAG
GSADAAAALVACDTLWGTGLSRDELAGIAADLGSDVPFLIHGGTALGTGRGEAVSPVLAR
PTSWHWVVAIADAGLSTPAAYRELDRLRDAGAAGTPLGSTDALLAALRQRDPRVLAATLG
NDLQDAALTMRPSLAETLKAGEAAGALAGIVSGSGPTCVFLATGEADAVRIAAEITAAGV
CREARVAHGPVAGARVV
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaggcatggcgaccgggggacgaggacgggcagcggcgcggggccagcggcccg
gtcaaggtgcgggtgcccgccaaggtcaacctgcatctcggggtcggaccgctgcggcgt
gacggctaccacgagctgaacaccgtctaccacgcgatctcgatctacgacgagctgacc
gcccgtcgcggcgacacgctcaccctcaccatggagggcgagggcgccggcgagctggcg
ctggacgacaccaacctggcgctgcgcgccgcgcacgcgctggccggttacgcgggcgtc
gccccgcacgcccggctgcacctgcgcaagcagatcccgctcgccggcgggctggccggt
ggcagcgccgacgccgccgccgcgctcgtcgcctgcgacacgctctggggcaccgggctg
tcccgcgacgagctcgccggcatcgccgccgacctcggctcggacgtcccgttcctcatc
cacggcggcaccgcgctcggcaccggccgcggcgaggcggtcagcccggtgctggcccgc
cccacctcctggcactgggtggtggcgatcgccgacgccggcctgtccaccccggccgcg
taccgggaactggaccggctgcgtgacgccggagccgccggcacgccgctgggcagcacc
gacgcgctgctcgccgcgctgcgccagcgcgacccgcgggtgctcgccgccacgctcggc
aacgacctccaggacgccgcgctgaccatgcgcccctcgctggccgagacgctcaaggcc
ggcgaggccgcgggggcgctcgccggcatcgtctccggctccggacccacctgcgtcttc
ctcgccaccggcgaggccgacgccgtccggatcgccgccgagatcaccgccgccggggtg
tgccgggaggcccgcgtcgcgcacggtccggtcgccggcgcccgcgtggtctga

DBGET integrated database retrieval system