KEGG   Micromonospora aurantiaca: Micau_0756Help
Entry
Micau_0756        CDS       T01296                                 

Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
mau  Micromonospora aurantiaca
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:mau00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
742359..743192
Genome map
AA seq 277 aa AA seqDB search
MGSPPMIDGGFARWLASRAGQALTALRAEMGFADAGALRSAGDKVSHDLIRTELAKWRPA
DAVLSEEDEGSRLAWTAEVTDAALSRLTADRVWIVDPLDGTREYAEEGRADWAVHVALWS
RNASRPHGLVAGAVALPAQHRVLGTDHPPAYPPMTVEAATGGGARVIRLAASRSRPPVFL
TDLAEDVGAHLVPMGSAGAKIAAVVTGEVDAYIHAGGQYEWDSAAPVAVATATGLHASRI
DGSALKYNGADPRLPDLLVCRKDLASRLLAALQRHSG
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgggcagtcctccgatgatcgacggcgggttcgcccggtggctggcgtcccgggccggt
caggcgctgacggccctgcgcgcggagatgggcttcgccgacgcgggcgcgctccggtcg
gccggcgacaaggtctcgcacgatctgatccgcaccgagctggcgaagtggcggccggcg
gacgcggtgctgtcggaggaggacgagggctcgcggctggcctggacggcggaggtgaca
gacgcggcgctgtcgcgcctgaccgcggaccgggtctggatcgtcgacccgctggacggc
acccgggagtacgcggaggaggggcgcgcggactgggcggtgcacgtggcgctctggtcg
cgtaacgcgtcgcggccgcacggtctggtggcgggcgcggtggcgctgccggcccagcac
cgggtgctcggcacggaccacccgccggcgtacccgccgatgacagtggaggcggccacc
gggggcggcgcgcgggtcatccgcttggcggccagccgtagccgtccgccggttttcctg
accgacctggcagaggacgtcggcgctcatctggttccgatgggctcggcgggcgcgaag
atcgccgccgtggtcacgggtgaggtcgacgcgtacatccacgcgggcggtcagtacgag
tgggattcggccgctccggtcgctgtggcgacggccaccggtctgcatgcttcccggatc
gacggttctgcgctgaaatacaacggggccgacccgcgcctaccggatctgctggtctgc
cgcaaggatctcgcgagtcggttgcttgcagcgttgcagcggcattccgggtaa

DBGET integrated database retrieval system