KEGG   Micromonospora aurantiaca: Micau_0779Help
Entry
Micau_0779        CDS       T01296                                 

Definition
pyrimidine-nucleoside phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mau  Micromonospora aurantiaca
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mau00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
768751..770031
Genome map
AA seq 426 aa AA seqDB search
MSAFTAVDVIRAKRDGGVLSDGQIDWVVDAYTKGLVADEQMSALAMAILLRGMTAPEIAR
WTAAMIASGERLDLSPVSRPTVDKHSTGGVGDKITLPLTPLVAACGAAVPQLSGRGLGHT
GGTLDKLESIPGWRAALTNDEFIAQLRDVGAVICAAGDGLAPADRKLYALRDVTGTVEAI
PLIASSIMSKKIAEGTGALVLDVKVGSGAFMKNVDDARELARTMVELGGAHGVRTVALLT
DMSTPLGLAVGNAVEVTESVEVLAGGGPADVVELTLALAREMLDAAGLPDADPEAALRDG
RAMDSWRTMIRAQGGDPDAPMPTANEVELVTATEDGWVADVDAYAIGVAAWRLGAGRARK
EDPVSIPAGVVLHKRRGDRVRVGDPLFELRAEHAERMPAALDEARRAVRVAPDAPDATPL
VVERIG
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgcttttacggcggttgacgtcatccgggcgaagcgggacgggggtgtgctgagc
gacgggcagatcgactgggtggtcgacgcgtacaccaagggtctggtcgccgacgagcag
atgtcggcgctggccatggcgatcctgctgcgcggcatgaccgccccggagatcgcccgg
tggaccgccgccatgatcgccagcggcgagcggctcgacctgtcgccggtgtcccggccg
acggtggacaagcactccaccggcggcgtcggtgacaagatcaccctgccgctgaccccg
ctggtggccgcgtgcggcgcggcggtgccgcagctgtccggccggggcctgggccacacc
ggcggcacgctggacaagctggagtcgatcccgggctggcgggcggcgctcaccaacgac
gagttcatcgcccagctccgcgacgtgggggcggttatctgcgcggccggcgacgggctc
gccccggccgaccgcaagctgtacgcgttgcgcgacgtcaccggcaccgtcgaggcgatc
ccgctgatcgccagctcgatcatgagcaagaagatcgccgaggggaccggcgcgctggtg
ctcgacgtgaaggtcggctccggcgcgttcatgaagaacgtcgacgacgcccgcgagctg
gcccgcaccatggtcgagctgggcggcgcgcacggcgtacggacggtcgccctgctcacc
gacatgtccaccccgctcggcctcgcagtgggcaacgcggtcgaggtgaccgagtcggtg
gaggtgctcgccggtggcggtccggccgacgtggtggagctgacgctggcactggcccgg
gagatgctcgacgcggccgggctgccggacgccgacccggaggcggcactgcgggacggc
cgggcgatggactcctggcgcacgatgatccgggcgcagggcggtgacccggacgcaccg
atgcccaccgcgaacgaggtcgagctggtcaccgccaccgaggacggctgggtcgccgac
gtcgacgcgtacgcgatcggggtggccgcgtggcgtctcggcgcgggccgggcccgcaag
gaggacccggtgagcatcccggccggcgtggtgctgcacaagcgccgcggtgaccgggtg
cgcgtcggcgacccgctgttcgagctgcgggccgagcacgccgagcggatgcccgccgcg
ctggacgaggcgcgccgcgcggtgcgggtggcaccggacgcgccggacgcgacgcctctg
gtcgtcgagcggatcggctga

DBGET integrated database retrieval system