KEGG   Micromonospora aurantiaca: Micau_0951Help
Entry
Micau_0951        CDS       T01296                                 

Definition
F420-dependent oxidoreductase
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
mau  Micromonospora aurantiaca
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Micau_0951
Enzymes [BR:mau01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.31  coenzyme F420-0:L-glutamate ligase
     Micau_0951
    6.3.2.34  coenzyme F420-1:gamma-L-glutamate ligase
     Micau_0951
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(958634..959719)
Genome map
AA seq 361 aa AA seqDB search
MRLEILPVQGIGDVTEGDDLAALITGAAPWLRDHDVLVVTSKIVSKAEGRLVDVPADGPE
RLAERDRILAGETARVVATRGATRIVQTHHGFVMASAGIDASNVDKTRLVLLPVDPDASA
RALRAALRDRYGLDVAVIVSDTMGRPWRNGLTDVALGVAGMPAIRDHRGEVDPYGNELSV
TQMAVVDELAAAGELIKGKCDQVPVAVVRGYLAATRDDDEGARTLVRDASMDLFSLGTAE
ARAAGLRAAATLADRIGPEPADPAAVRRAIDAVADVVAPGTVFTHVTDDEVRAGLAATVP
GWPASATGLLLGAAPAPVDPADLVRVGADLQRLRAALAAEGVDSTLLPPPSGSTASATLA
L
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtgaggctggagatcctgccggtgcagggcatcggtgacgtgaccgagggcgacgacctg
gcggcgctgatcaccggcgcggcgccctggctgcgcgaccacgacgtcctggtggtcacc
agcaagatcgtgtcgaaggcggagggccggctggtcgacgtgccggccgacggcccggaa
cggctcgccgagcgggaccgcatcctggccggggagaccgcccgggtggtggcgacccgg
ggcgcgacccggatcgtgcagacccaccacgggttcgtgatggcctccgccggcatcgac
gcctcgaacgtggacaagaccaggctggtgctgctgcccgtcgacccggacgcgtccgcc
cgggcgctgcgcgccgcgttgcgcgaccggtacggcctcgacgtcgcagtgatcgtcagc
gacacgatgggacgcccgtggcgcaacgggctcaccgacgtggcgctcggggtggccggc
atgccggcgatccgtgaccaccggggcgaggtcgacccgtacggcaacgagctgtccgtc
acccagatggcggtggtcgacgaactcgccgccgccggtgagctgatcaagggcaagtgc
gaccaggtgccggtcgcggtggtccggggttacctcgccgcgacccgggacgacgacgag
ggcgcccgcacgctcgtgcgcgacgcctcgatggacctgttctcgctcggcacggccgag
gcgcgcgccgccggtctgcgggcggcggcgacgctcgcggaccggatcggccccgagccc
gccgatccggccgcggtgcggcgggcgatcgacgcggtggccgacgtggtcgcgcccggc
accgtcttcacccacgtcaccgacgacgaggtacgcgccggactcgccgccaccgtgccc
ggctggcccgcctcggccaccggcctgctactcggcgcggcgcccgcccccgtcgacccg
gcggacctggtccgggtcggcgcggacctgcaacgcctgcgcgccgcgctggccgccgag
ggcgtcgactcgacgttgctcccgcccccgtccggcagcaccgcgagcgccacgctggcg
ctctga

DBGET integrated database retrieval system