KEGG   Micromonospora aurantiaca: Micau_0970Help
Entry
Micau_0970        CDS       T01296                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mau  Micromonospora aurantiaca
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mau00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
978911..979924
Genome map
AA seq 337 aa AA seqDB search
MTRYGPMYGPDITFLGVPPCTVEEPVTYADADVVVIGAPFDGGTSHRPGTRFGPSAIRQA
CYLPHDGSRPSLALRVDGLKDLCVYDAGDVEMFSGDIERSLAALETAVHAVAAAGAIPVV
LGGDHSIALPDATGVARHHGLGRVSLVHFDAHADTGDVEFGSLHGHGQPMRRLIESGAVR
GDRFLQIGLRGYWPGPDTLAWMAEQRMRSYEMTEVVARGLDTCLTEAFGIATDECEGVFL
SVDVDVVDPGMAPGTGTPEPGGFTSRQLLDAVRRVCYELPVVGLDVVEVAPPYDHADITA
YLGNRVVLEALSAIARRRHDAAGGPPWNPTQPLLDNR
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgacccggtacggcccgatgtacggtcccgacatcacgttcctcggcgtgccaccgtgc
acagtcgaggaaccggtcacgtacgccgacgcggacgtggtggtcatcggggcgccgttc
gacggcggcacctcgcaccggccgggcacccggttcgggccgtccgccatccggcaggcc
tgctacctgccgcacgacggctcccgtccgtcgctggcgctgcgcgtcgacgggctgaag
gacctgtgcgtctacgacgccggcgacgtggagatgttcagcggcgacatcgagcgctcg
ctggccgcgctggagaccgccgtgcacgcggtcgccgccgccggggcgatcccggtggtg
ctcggcggtgaccactccatcgcgctgcccgacgccaccggcgtggcccggcaccacggg
ctcggtcgggtgtcgctcgtgcacttcgacgcgcacgccgacaccggcgacgtcgagttc
ggctcgctgcacggccacggtcagccgatgcgccggctcatcgagtccggcgcggtacgc
ggcgaccgcttcctgcagatcgggctgcgcggctactggcccggcccggacacgctggcg
tggatggcggagcagcggatgcgctcgtacgagatgaccgaagtcgtggcgcgcggcctg
gacacctgcctcaccgaggcgttcggcatcgcgaccgacgagtgtgagggcgtgttcctc
tccgtcgacgtggacgtggtcgacccgggcatggcacccggcaccggcacgcccgagccg
ggcgggttcacctcccggcaactgctcgacgcggtgcgccgggtctgttacgagctgccg
gtggtcgggctggacgtggtcgaggtagccccgccgtacgaccacgccgacatcaccgcg
tacctgggcaaccgggtggtgctggaggcgttgtccgcgatagcccgccgccgccacgac
gccgccggcggacccccgtggaaccccacccagccgctcctggacaaccgctga

DBGET integrated database retrieval system