KEGG   Micromonospora aurantiaca: Micau_1045Help
Entry
Micau_1045        CDS       T01296                                 

Definition
magnesium chelatase, ChlI subunit
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
mau  Micromonospora aurantiaca
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Micau_1045
Enzymes [BR:mau01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Micau_1045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1059481..1060983
Genome map
AA seq 500 aa AA seqDB search
MDRVTAPNQVSPVPPADLPSTLGELRATGHRYRTVKQELRDNLLARMGSGEDRFPGIVGY
EDTVLPEVERALLAGHDMVLLGERGQGKTRLIRSLGALLDEWTPVIPGSVLNEHPMHPLT
PASQALVDSAGDDLAIGWLHRSMRYGEKLATPDTSVGDLIGDVDPIRLAQGRTLGDPETI
HFGLVPRTNRGVFAVNELPDLAERIQVALLNVLEERDIQVRGYQLRLPLDLLLVASANPE
DYTNRGRIITPLKDRFGAEIRTHYPLDLDLELALIRQEADLVAVVPEHVLEVLARFARDV
RESPSVDPRSGVSARFAIAAAETVAAAALRRSGLLAGASAGAGAGVGASGGAAGAASRPE
APVARIGDTVSVTSTLRGKVEFESGEEGREIEVLAHLLRTATAETFRARLAGLDLSGFTA
IVAEGGAVETGELVSSSELLRQVGTVPGLAKVLDRLGLGDAPSPEEAAAGIEFVLEGLHL
TRRLGKDVTDSGRTVYGDRD
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
gtggatcgggtgaccgctcccaaccaggtttccccggtcccgcccgccgacctgccgagc
acgctcggcgagttgcgcgctaccggccaccgctaccgcacggtcaaacaggaactccga
gacaacctcctcgcccggatgggctccggcgaggaccgcttccccggcatcgtgggctac
gaggacacggtgctgcccgaggtcgagcgcgcgctgctcgccgggcacgacatggtgctg
ctcggcgagcgcgggcaaggcaagacccggctgatccgttcgctcggcgcgctgctggac
gagtggaccccggtgatccccggctcggtactcaacgagcacccgatgcacccgctcacc
ccggcgtcccaggcgctcgtcgactcggccggcgacgacctggcgatcgggtggctgcac
cgctcgatgcggtacggcgagaagctcgccacgccggacaccagcgtcggtgacctgatc
ggcgacgtcgacccgatccgcctcgcccaggggcgcacgctcggcgacccggagaccatc
cacttcgggctcgtaccgcgtaccaaccggggcgtcttcgccgtcaacgagctgcccgac
ctggccgaacgcatccaggtggcgctgctcaacgtgctggaggaacgcgacatccaggtc
cgcggctaccagctacggctgccgctggacctgctgctggtggccagtgccaacccggag
gactacaccaaccggggccggatcatcacgccgctgaaggaccggttcggcgcggagatc
cgtacccactacccgctcgacctggacctggagctggcgctgatccggcaggaggccgac
ctggtcgccgtcgtgccggagcacgtgctggaggtgctggcccggttcgcccgcgacgtg
cgggagtcgccgtcggtggacccgcgctccggtgtgtccgcccggttcgccatcgccgcc
gcggagacggtggccgccgccgcgctgcgccgttcgggtctgctggccggtgcttctgcc
ggcgctggtgccggcgtcggtgcctcgggtggggcggctggggcggcgtcccggccggag
gcgcctgtggcccggatcggggacaccgtgtcggtgacctccacgctgcgcggcaaggtc
gagttcgagagcggcgaggagggacgcgagatcgaggtgctcgcgcacctgctgcgtacc
gccaccgccgagacgttccgcgcccggctcgccgggctcgacctgtccggcttcaccgcg
atcgtcgccgagggcggcgccgtcgagaccggcgagctggtctcctcgtccgagctgctg
cgccaggtcggcaccgtgccggggctggccaaggtgctcgaccggctcgggctcggcgac
gcgcccagcccggaggaggcggccgccggcatcgagttcgtgctggaagggctgcacctg
acccgccggctcggcaaggacgtcaccgactccgggcgcaccgtctacggggaccgggac
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system