KEGG   Micromonospora aurantiaca: Micau_1143Help
Entry
Micau_1143        CDS       T01296                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mau  Micromonospora aurantiaca
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Micau_1143
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Micau_1143
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Micau_1143
Enzymes [BR:mau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Micau_1143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1158156..1159337)
Genome map
AA seq 393 aa AA seqDB search
MHLTHLECPRCGSEHPADVLQNLCGCGSPLLARYDLAAVAATVAPEQFGLRPADLWRYRE
LLPVADPRFVTTLGEGWTPMWRAPAYGHEIGIADLIVKDEGLAPTGSFKARGASVGVSRA
RELGVKRIAMPTNGNAGAAWATYAARAGMGATIAMPLAAPTICREECLAAGADLRLIDGL
INDAGRDIAELIAGSDGGIFDAGTLREPYRLEGKKTMGYEIVEQLGWQVPDVIVYPTGGG
VGLIGIHKALHELRELGWVEDRLPRLVAVQSTGCAPIVRAFAAGEERVTPWEDAHTVAFG
ITVPAPLGDELILSALRDSAGTAIAVDDAEILTDLRDFAAREGLLLCPEGAACLTAARHL
RAGGWIRPGERVVVLNTGAGLKYPGLVQGGAPS
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtgcacctgacgcacctggagtgcccgcgctgcggcagtgaacacccggccgacgtgttg
cagaacctgtgcggctgcggctcgccgctgctggcccgctacgacctcgccgcggtggcc
gccacggtcgccccggagcagttcgggctgcgcccggccgacctgtggcgctaccgggag
ctgctgccggtggccgatccccgcttcgtcaccacgctgggcgagggctggacgccgatg
tggcgcgcgccggcgtacggccacgagatcggcatcgcggacctgatcgtcaaggacgag
gggctggccccgaccgggtcgttcaaggcgcgcggcgcgtcggtgggcgtgagccgggcc
cgggagctgggcgtgaagcggatcgccatgcccacgaacggcaacgccggcgcggcctgg
gccacgtacgcggcgcgggccgggatgggcgcgacgatcgccatgccgctggccgcgccg
acgatctgccgcgaggagtgcctcgccgccggcgccgacctgcggctgatcgacggcctg
atcaacgacgcgggccgggacatcgccgagctgatcgccgggtcggacggggggatcttc
gacgccggcacgctgcgcgagccgtaccgcctcgaaggcaagaagaccatggggtacgag
atcgtcgagcagctcggctggcaggtgcccgacgtgatcgtctatccgaccggcggtggc
gtcgggctgatcggcatccacaaggcgctgcacgagctgcgcgaactgggctgggtggag
gaccggctgccccggctggtcgcggtgcagtccaccgggtgcgcgccgatcgtgcgggcg
ttcgcggccggggaggagcgcgtcaccccgtgggaggacgcgcacaccgtcgcgttcggc
atcaccgtgcccgcgccgctcggcgacgagctgatcctgtccgcgctgcgggacagcgcc
ggcaccgcgatcgcggtggacgacgcggagatcctcaccgacctgcgtgacttcgccgcc
cgggaagggctgctgctctgcccggagggcgcggcctgcctgaccgccgcccggcacctg
cgcgcgggcgggtggatccggcccggggagcgcgtggtggtgctcaacaccggcgccggc
ctgaaataccccggcctggtgcaaggaggggccccttcttaa

DBGET integrated database retrieval system