KEGG   Micromonospora aurantiaca: Micau_1240Help
Entry
Micau_1240        CDS       T01296                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mau  Micromonospora aurantiaca
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Micau_1240
Enzymes [BR:mau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Micau_1240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1271716..1272612
Genome map
AA seq 298 aa AA seqDB search
MPQTRIAVVGSANMDLVGIGAALPRPGETVLGDDFVMLPGGKGANQAVAAVRAGASCVFL
GAIGSDSFGVTLRARMTAAGVDTDHLRVVYGPSGVALVMVGGAGENAILVTPGANAAFTS
LTAGELSAVRDADVLVAQLEVPVETVTEAALAARSAGTRVVLNAAPARSVPAELLAATDL
LVVNEPEAQALTGRGRDEPAALLDLVPRAVLTLGGDGAWYVDRDRPPTHVPAVPVDVVDS
TTAGDAFTAALAVAWGEGRDLADAVRWAAAAGAACVRKLGASVALPHRAEIDELFPGG
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
gtgccgcagacccggatcgccgtcgtcggcagtgccaacatggacctggtcggcatcggc
gccgcgctgccccggcccggcgagacggtgctgggcgacgacttcgtcatgctgcccggc
ggcaagggcgccaaccaggcggtcgccgcggtacgcgccggcgcgtcctgtgtcttcctg
ggcgcgatcggctcggactcgttcggcgtgacgctacgggcccgcatgacggcggccggc
gtggacaccgaccacctgcgggtggtctacggcccgtccggcgtcgcgctggtgatggtc
ggcggcgcgggggagaacgccatcctggtcacccccggggcgaacgctgcgttcacgtcg
ctgaccgccggcgagctttccgccgtacgcgatgcggacgtgctggtcgcgcagctggag
gtgccggtcgagacggtgaccgaggcggcgctggcggcccggtccgcgggcacccgggtg
gtgctcaacgccgcgccggcccgatcggtgccggccgagctgctggcggccaccgacctg
ctcgtggtgaacgagccggaggcgcaggcgctgaccggtcgcggccgggacgagccggcg
gcgctgctcgacctggtgccccgggcggtgctcacgctcggcggcgacggcgcctggtac
gtcgaccgggaccgcccgccgacgcacgtgccggccgtgccggtggacgtggtcgactcg
accaccgccggggacgcgttcaccgccgcgctcgcggtggcctggggcgaggggcgggac
ttggccgacgcggtccgctgggcggcggccgccggtgcggcgtgcgtgcgcaagctcggc
gcctcggtggcgctgccgcaccgcgcggagatcgacgagctgttccccggcggttaa

DBGET integrated database retrieval system