KEGG   Micromonospora aurantiaca: Micau_1628Help
Entry
Micau_1628        CDS       T01296                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
mau  Micromonospora aurantiaca
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Micau_1628
Enzymes [BR:mau01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Micau_1628
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1697907..1699316
Genome map
AA seq 469 aa AA seqDB search
MVRPWRVAIVGGGITGLAAAVRLRDRAPEGTEITVYEQSGRLGGKLHTGELAGGPVEFGA
ESFLMRDPAGGESAAVTLARRLGLDASIVHPTVGQAALLVDGTLRQVPGGTLVGVPGDLD
KVAAVAPPAADADRDAGHPLLAEGEDTSVGELVRKRLGDAVVERLVDPMLGGVYAGRADD
LSLVTTMPALARAARAEHTLVGAVRAAQAAAPRAPGAPVFGTLAGGLSTLVEAAAAASGA
TIRRGAAVRELRRTPDGWRLTVGPTRDAEHVEADAVVLAVPARPAARLLAAAAPEAAGTV
GALDYASVALITLALPGPALPELSGFLVPAGEGLTIKASTFFTTKWGHLRRPDGLALVRA
SVGRYGDETSLQLTDDDLADTVHRELSAVLGAPLPAPVARHVQRWGGALPQYTPGHTARV
AAVRTALRAAHPTLAVAGAGYDGVGIPVCVRSGETAAEEIITALEGSAA
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
gtggtgcgaccgtggcgggtggcgatcgtcggtggcgggatcaccgggctggccgccgcc
gtccggttgcgcgaccgggcgcccgagggcaccgagatcaccgtgtacgagcagtccggc
cgcctcggcggcaagctgcacaccggtgagctggccggcggcccggtcgagttcggcgcg
gagtcgttcctgatgcgcgacccggccggtggcgagtcggcggcggtgacgctggcccgc
cgcctcggactggacgcgtcgatcgtgcacccgaccgtcgggcaggcggccctgctcgtc
gacggcacgttgcgccaggtcccgggcgggacgctcgtcggcgtacccggggatctggac
aaggtggcggcggtcgcgccgccggccgcggacgccgaccgcgacgcgggccacccgctg
ctggccgagggtgaggacacctcggtcggtgagctggtccgcaagcgtctcggagacgcg
gtggtggagcggctggtcgacccgatgctcggcggcgtgtatgccgggcgggccgacgac
ctgtcgctcgtcaccacgatgccggcgctggcccgcgcggcccgcgccgagcacacgctg
gtcggtgcggtacgcgccgcgcaggccgccgcgccgcgcgcgcccggcgcaccggtcttc
ggcacgctcgccggtgggctgagcacgctggtcgaggcggcggcggcggcgagcggggcg
acgatccgccggggcgccgcggtacgcgagttgcgccgcaccccggacggctggcggctc
acagtcgggccgacccgcgacgccgagcacgtcgaggcggacgcggtggtgctcgcggtg
ccggcccgcccggccgcccggctgctcgccgccgccgcgcccgaggcggccggcacggtg
ggcgcgctcgactacgcgagcgtcgccctgatcaccctcgcgctgccggggccggccctg
ccggagctgtccggcttcctggtgccggccggcgaagggctgacgatcaaggcgtccacg
ttcttcaccaccaagtgggggcacctgcggcggccggacgggctggcgctggtgcgcgcc
tcggtgggccggtacggcgacgagacgtcgctgcagctcaccgacgacgacctggccgac
acggtgcaccgggagctgtcggcggtgctcggcgcgccgctgccggcgccggtggcccgg
cacgtgcagcggtggggtggcgcgctgccccagtacacgcccgggcacaccgcccgggtg
gcggcggtccggacggcgctgcgcgccgcccacccgacgcttgcagtggccggggccggt
tacgacggcgtcggcatcccggtgtgcgtccgctccggcgagacggcggccgaagagatc
atcacggcactggaaggatcggcagcatga

DBGET integrated database retrieval system