KEGG   Micromonospora aurantiaca: Micau_1696Help
Entry
Micau_1696        CDS       T01296                                 

Definition
(GenBank) Phosphoketolase
  KO
K01621  xylulose-5-phosphate/fructose-6-phosphate phosphoketolase [EC:4.1.2.9 4.1.2.22]
Organism
mau  Micromonospora aurantiaca
Pathway
mau00030  Pentose phosphate pathway
mau01100  Metabolic pathways
mau01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Micau_1696
Enzymes [BR:mau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Micau_1696
    4.1.2.22  fructose-6-phosphate phosphoketolase
     Micau_1696
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: XFP_N XFP_C XFP TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: ADL45251
JGI: Micau_1696
UniProt: D9SZW9
Position
complement(1776218..1778620)
Genome map
AA seq 800 aa AA seqDB search
MDTAVNLHSPLTEDELRRLDAYWRAANYLTVGQIYLLDNPLLREPLKPEHVKPRLLGHWG
TSPGLNLLYTHLNRVIVNQDLSAIFVTGPGHGGPALVANTWLEGTYSELYHHIPRDETGM
QRLFRQFSFPGGIPSHVAPEVPGSIHEGGELGYALSHAYGAAFDNPDLLVACVIGDGEAE
TGPLAGSWLSNVFLNPARDGAVLPILHLNGYKIANPTVLDRIPREDLRDMMRGFGYEPYV
VEGDDPATVHQLLAATLDRAVDEITAIQRRARSGEHVERPRWPMIVLRTPKGWTGPSRVD
GKQVEGTFRAHQVPISEVRDNPEHLAELERWLRSYRPEELFDATGAPVAEVADLPPTGDH
RMSANPVANGGRLLRNLELPDFRDYAVDVPTPGEPMAGATGVLGPWVRDVIARNPETFRL
FGPDEVASNRLGAAFEVTDRAFVGAEVPGDDHLSPDGRVMEVLSEHLCQGWLEGYLLTGR
HGIFTSYEAFIHIVDSMVNQHAKWLKVTRNIPWREPVASLNYLLSSHVWRQDHNGFSHQD
PGFIDHVVNKKAEVVRVYLPPDGNTLLSTMDHCLRSRQYINVVVAGKQPAPNWLTMDEAI
QHCRRGLGIWDWASSDDGTEPDVVLACAGDVPTLETLAAVDLLRRHLPDLKVRVVNVVDL
MRLQPPSEHPHGLPDNEFDTIFTRDKPVIFAYHGYPWLIHRLTYRRTNHENLHVRGYKEE
GTTTTPFDMVMLNDLDRFHLVIDVIDRVPGLRSRAAHLRQDMVDARQACRDYTRRYGEDD
PRVAEWRWIRENDPAVRSGE
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atggacaccgcggtgaacctgcacagccccctgaccgaagacgagttgcgccggctggac
gcctactggcgcgcggcgaactacctgaccgtcggccagatctatctgctcgacaatccg
ctgctgcgcgaaccgctcaagcccgagcacgtcaagccgcgcctgctgggccactggggc
accagccccgggctcaacctgctctacacgcacctcaaccgggtcatcgtgaaccaggac
ctgtccgccatcttcgtcaccggccccggccacggcggcccggcgctggtggcgaacacc
tggctggagggcacctacagcgagctgtaccaccacatcccccgggacgagaccggcatg
cagcggctgttccggcagttctccttcccgggcggcatcccgagccacgtggcgccggag
gtgccgggttcgatccacgagggcggcgagctggggtacgcgctgagccacgcgtacggc
gccgcgttcgacaacccggacctgctcgtggcctgcgtgatcggcgacggcgaggcggag
accggcccgctggccggcagctggctgtcgaacgtgttcctcaacccggcccgcgacggc
gcggtgctgccgatcctgcacctcaacggctacaagatcgccaacccgacggtgctggac
cggatcccccgcgaggacctgcgggacatgatgcgcggcttcggctacgagccgtacgtg
gtcgagggcgacgacccggcgacggtgcaccagctgctggccgccacgctcgaccgggcg
gtcgacgagatcaccgcgatccagcgccgggcccgctccggcgagcacgtcgagcgtccc
cgctggccgatgatcgtcctgcggacgccgaagggctggaccgggccgtcccgggtcgac
ggcaagcaggtcgagggcacgttccgcgcccaccaggtgccgatctccgaggtgcgggac
aaccctgagcacctggccgagctggagcgctggctgcgcagctaccggccggaggagctg
ttcgacgccaccggcgccccggtcgccgaggtggccgacctgccgcccacaggtgaccac
cggatgagcgccaacccggtcgccaacggcggcaggctgctgcgcaacctggagctgccg
gacttccgcgactacgcggtcgacgtaccgacgccgggtgagccgatggccggcgcgacg
ggtgtgctcgggccctgggtccgcgacgtgatcgcccgcaacccggagacgttccgcctg
ttcggcccggacgaggtggcctcgaaccggctcggcgcggcgttcgaggtgaccgaccgc
gcgttcgtgggcgccgaggtgcccggcgacgaccacctctcccccgacggccgggtgatg
gaggtgctctccgagcacctgtgccagggctggctggagggctacctgctgaccggtcgg
cacggcatcttcaccagctacgaggcgttcatccacatcgtcgactcgatggtcaaccag
cacgccaagtggctgaaggtgacccggaacatcccctggcgggagccggtggcgtcgctg
aactacctgctgtccagccacgtgtggcgccaggaccacaacggcttctcgcaccaggat
ccgggcttcatcgaccacgtggtgaacaagaaggccgaggtggtccgggtctacctgccg
ccggacggcaacacgctgctgtccacgatggatcactgcctgcgcagccggcagtacatc
aacgtggtggtggccggcaagcagcccgcgccgaactggctgaccatggacgaggcgatc
cagcactgccgccgcggcctgggcatctgggactgggccagcagcgacgacggcaccgag
ccggacgtggtgctcgcctgcgccggtgacgtgccgacgctggagacgctcgccgccgtc
gacctgctgcgccggcacctgccggacctgaaggtgcgggtcgtcaacgtggtcgacctg
atgcgcctgcaaccgccgtcggagcacccgcacggcctgccggacaacgagttcgacacc
atcttcacccgcgacaagccggtgatcttcgcgtaccacggctacccgtggctgatccac
cggctcacctaccgccggaccaaccacgagaacctgcacgtgcgcggttacaaggaggag
ggcaccaccacgaccccgttcgacatggtgatgctcaacgacctggaccgcttccacctg
gtcatcgacgtgatcgaccgggtgccggggctgcggtcgcgcgccgcgcacctgcgccag
gacatggtggacgcccgccaggcctgccgcgactacacccgccgctacggcgaggacgac
ccccgggtcgccgagtggcgctggatccgcgagaacgacccggccgtgaggagtggggaa
tga

DBGET integrated database retrieval system