KEGG   Micromonospora aurantiaca: Micau_1696Help
Entry
Micau_1696        CDS       T01296                                 

Definition
phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
mau  Micromonospora aurantiaca
Pathway
Pentose phosphate pathway
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:mau00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1776218..1778620)
Genome map
AA seq 800 aa AA seqDB search
MDTAVNLHSPLTEDELRRLDAYWRAANYLTVGQIYLLDNPLLREPLKPEHVKPRLLGHWG
TSPGLNLLYTHLNRVIVNQDLSAIFVTGPGHGGPALVANTWLEGTYSELYHHIPRDETGM
QRLFRQFSFPGGIPSHVAPEVPGSIHEGGELGYALSHAYGAAFDNPDLLVACVIGDGEAE
TGPLAGSWLSNVFLNPARDGAVLPILHLNGYKIANPTVLDRIPREDLRDMMRGFGYEPYV
VEGDDPATVHQLLAATLDRAVDEITAIQRRARSGEHVERPRWPMIVLRTPKGWTGPSRVD
GKQVEGTFRAHQVPISEVRDNPEHLAELERWLRSYRPEELFDATGAPVAEVADLPPTGDH
RMSANPVANGGRLLRNLELPDFRDYAVDVPTPGEPMAGATGVLGPWVRDVIARNPETFRL
FGPDEVASNRLGAAFEVTDRAFVGAEVPGDDHLSPDGRVMEVLSEHLCQGWLEGYLLTGR
HGIFTSYEAFIHIVDSMVNQHAKWLKVTRNIPWREPVASLNYLLSSHVWRQDHNGFSHQD
PGFIDHVVNKKAEVVRVYLPPDGNTLLSTMDHCLRSRQYINVVVAGKQPAPNWLTMDEAI
QHCRRGLGIWDWASSDDGTEPDVVLACAGDVPTLETLAAVDLLRRHLPDLKVRVVNVVDL
MRLQPPSEHPHGLPDNEFDTIFTRDKPVIFAYHGYPWLIHRLTYRRTNHENLHVRGYKEE
GTTTTPFDMVMLNDLDRFHLVIDVIDRVPGLRSRAAHLRQDMVDARQACRDYTRRYGEDD
PRVAEWRWIRENDPAVRSGE
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atggacaccgcggtgaacctgcacagccccctgaccgaagacgagttgcgccggctggac
gcctactggcgcgcggcgaactacctgaccgtcggccagatctatctgctcgacaatccg
ctgctgcgcgaaccgctcaagcccgagcacgtcaagccgcgcctgctgggccactggggc
accagccccgggctcaacctgctctacacgcacctcaaccgggtcatcgtgaaccaggac
ctgtccgccatcttcgtcaccggccccggccacggcggcccggcgctggtggcgaacacc
tggctggagggcacctacagcgagctgtaccaccacatcccccgggacgagaccggcatg
cagcggctgttccggcagttctccttcccgggcggcatcccgagccacgtggcgccggag
gtgccgggttcgatccacgagggcggcgagctggggtacgcgctgagccacgcgtacggc
gccgcgttcgacaacccggacctgctcgtggcctgcgtgatcggcgacggcgaggcggag
accggcccgctggccggcagctggctgtcgaacgtgttcctcaacccggcccgcgacggc
gcggtgctgccgatcctgcacctcaacggctacaagatcgccaacccgacggtgctggac
cggatcccccgcgaggacctgcgggacatgatgcgcggcttcggctacgagccgtacgtg
gtcgagggcgacgacccggcgacggtgcaccagctgctggccgccacgctcgaccgggcg
gtcgacgagatcaccgcgatccagcgccgggcccgctccggcgagcacgtcgagcgtccc
cgctggccgatgatcgtcctgcggacgccgaagggctggaccgggccgtcccgggtcgac
ggcaagcaggtcgagggcacgttccgcgcccaccaggtgccgatctccgaggtgcgggac
aaccctgagcacctggccgagctggagcgctggctgcgcagctaccggccggaggagctg
ttcgacgccaccggcgccccggtcgccgaggtggccgacctgccgcccacaggtgaccac
cggatgagcgccaacccggtcgccaacggcggcaggctgctgcgcaacctggagctgccg
gacttccgcgactacgcggtcgacgtaccgacgccgggtgagccgatggccggcgcgacg
ggtgtgctcgggccctgggtccgcgacgtgatcgcccgcaacccggagacgttccgcctg
ttcggcccggacgaggtggcctcgaaccggctcggcgcggcgttcgaggtgaccgaccgc
gcgttcgtgggcgccgaggtgcccggcgacgaccacctctcccccgacggccgggtgatg
gaggtgctctccgagcacctgtgccagggctggctggagggctacctgctgaccggtcgg
cacggcatcttcaccagctacgaggcgttcatccacatcgtcgactcgatggtcaaccag
cacgccaagtggctgaaggtgacccggaacatcccctggcgggagccggtggcgtcgctg
aactacctgctgtccagccacgtgtggcgccaggaccacaacggcttctcgcaccaggat
ccgggcttcatcgaccacgtggtgaacaagaaggccgaggtggtccgggtctacctgccg
ccggacggcaacacgctgctgtccacgatggatcactgcctgcgcagccggcagtacatc
aacgtggtggtggccggcaagcagcccgcgccgaactggctgaccatggacgaggcgatc
cagcactgccgccgcggcctgggcatctgggactgggccagcagcgacgacggcaccgag
ccggacgtggtgctcgcctgcgccggtgacgtgccgacgctggagacgctcgccgccgtc
gacctgctgcgccggcacctgccggacctgaaggtgcgggtcgtcaacgtggtcgacctg
atgcgcctgcaaccgccgtcggagcacccgcacggcctgccggacaacgagttcgacacc
atcttcacccgcgacaagccggtgatcttcgcgtaccacggctacccgtggctgatccac
cggctcacctaccgccggaccaaccacgagaacctgcacgtgcgcggttacaaggaggag
ggcaccaccacgaccccgttcgacatggtgatgctcaacgacctggaccgcttccacctg
gtcatcgacgtgatcgaccgggtgccggggctgcggtcgcgcgccgcgcacctgcgccag
gacatggtggacgcccgccaggcctgccgcgactacacccgccgctacggcgaggacgac
ccccgggtcgccgagtggcgctggatccgcgagaacgacccggccgtgaggagtggggaa
tga

DBGET integrated database retrieval system