KEGG   Micromonospora aurantiaca: Micau_1711Help
Entry
Micau_1711        CDS       T01296                                 

Definition
(GenBank) Alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
mau  Micromonospora aurantiaca
Pathway
mau00052  Galactose metabolism
mau00561  Glycerolipid metabolism
mau00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Micau_1711
  Lipid metabolism
   00561 Glycerolipid metabolism
    Micau_1711
   00600 Sphingolipid metabolism
    Micau_1711
Enzymes [BR:mau01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Micau_1711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_36N Glyco_hydro_36C Peripla_BP_3 Melibiase_2
Motif
Other DBs
NCBI-ProteinID: ADL45266
JGI: Micau_1711
UniProt: D9SZY4
Position
complement(1790759..1792972)
Genome map
AA seq 737 aa AA seqDB search
MTIVHLRRARTSLVLDARGPGLPRVVHWGADLGPLPDEDLPAVVDATVPPVVPSSFDTPT
VLSLLPEASAGWSGRPGLAGHRDGRDWSTAFRLTGLDVYDEPAAPSPALLGGAPLHAPGV
NKGPFLSSGRVEVRAADPGAGLSLTVEITLDAAGVLTLRHRLRNDGDGRYEVRELTPVLP
VPAVATELLDLTGRWCRERAPQRHPWPMGAWVREGRHGRTGHDATLLLVAGTAGFGFRHG
EVWAVHTAWSGDHVTAAERRPTGESTLGGGELLAPGEIVLGPGEEYATPLLYAAHSADGL
DGLSDALHTHLRSRTSHPRTPRPVTLNVWEAVYFDHDLDRLRTLADAAAEVGVERFVLDD
GWFRGRRHDQAGLGDWWVDGEVWPDGLQPLIDHVRGHGMQFGLWVEPEMVNPDSDLFRAH
PDWVLQAPGRLPPPWRHQQVLDLAHPDAYAYLLERLDAVLSGHDGLAYLKWDHNRDLTEA
GHAGRPGVHAQTLAVYRLLDELRARHPDVEIESCSSGGARVDLEILRRTDRVWASDCNDA
LERLSIQRWTGLLLPPELIGTHIGPERSHTTHRVHDLSFRAVTALFGHHGIEWDITAIDA
GERAELAAWVALHKRLRPLLHTGQVVRVDHPDPAVQAHGVVAHDRNHAVYAVSRVATSAA
QVPGAVRLPGLDPQRRYRIRPPAGVPEPALLELSPPGWLAWPGDGITVSGSVLGTVGVQL
PALHPEQALLLEVTVVG
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcgtccacctgcgccgcgcgcggaccagcctggtgctcgacgcccgcggcccg
gggctgccccgggtcgtgcactggggcgccgacctcggcccgctgcccgacgaggacctg
cccgcggtcgtcgacgccacggtgccgccggtggtgccgagcagcttcgacacgcccact
gtgctgtcgctgctgcccgaggcgagcgccgggtggagcggacgtcccggtctcgccggt
caccgcgacggccgggactggtcgacggcgttccgcctcaccggcctcgacgtgtacgac
gagcccgcggcaccgtcgcccgccctgttaggaggggcccctttacatgcaccaggcgtt
aacaaggggcccttcctttcctccgggcgggtggaggtgcgggcggcggatccgggcgcg
gggctgagcctgaccgtcgagatcacgctggacgcggcgggcgtgctgacgctgcggcac
cggctgcgcaacgacggcgacggccggtacgaggtgcgggagctgacgccggtgctgccg
gtgcctgcggtcgccaccgaactgctcgacctgaccggccgctggtgccgggaacgcgcg
ccgcagcggcacccgtggccgatgggcgcctgggtacgcgaggggcggcacggccgtacc
ggccacgacgccacgttgttgctggtcgcgggcaccgccgggttcggtttccggcacggc
gaggtgtgggcggtgcacaccgcgtggagcggcgaccacgtcaccgccgccgagcgccgc
cccacaggtgagtccacgctcggcggcggtgagctgctcgcacccggcgagatcgtgctc
gggccgggcgaggagtacgccactcccctgctctacgcggcgcactcggccgacgggctg
gacgggctcagcgacgcgctgcacacccacctgcgatcacgcacctcgcacccccgcacg
ccgcgaccggtgacgctgaacgtgtgggaggcggtctacttcgaccacgacctggaccgg
ctgcggacgctggccgacgcggccgccgaggtcggtgtggaacgcttcgtgctggacgac
ggctggttccgtggccgacgacacgaccaggccgggctgggcgactggtgggtcgacggc
gaggtctggccggacgggttgcagccgctgatcgaccacgtacgcgggcacggcatgcag
ttcgggctctgggtggaaccggagatggtcaaccccgactccgacctgttccgcgcccat
cccgactgggtgctccaggcgccgggccggctgccgccgccgtggcggcaccagcaggtg
ctcgacctggcccacccggacgcgtacgcgtacctgctcgaacggctcgacgcggtgctg
agcgggcacgacgggctcgcgtacctgaagtgggaccacaaccgcgacctcaccgaggcc
gggcacgccgggcggcccggggtgcacgcgcagaccctcgcggtctaccggttgctggac
gagctgcgcgcccggcacccggacgtcgagatcgagagctgctcctccggcggcgcgcgc
gtcgacctggagatcctgcgccgcaccgaccgggtctgggccagcgactgcaacgacgcg
ctggaacggctgtccatccagcgctggaccggcctgctgctgccgccggaactgatcggc
acgcacatcggcccggagcgctcgcacaccacgcaccgcgtgcacgacctgagcttccgc
gcggtcaccgcgctgttcggccaccacggcatcgagtgggacatcaccgcgatcgacgcc
ggcgaacgggccgaactcgccgcctgggtggcgctgcacaagcggctgcgcccgctgctg
cacaccggccaggtggtccgggtcgaccacccggacccggccgtgcaggcccacggcgtg
gtcgcccacgaccgcaaccatgcggtgtacgcggtcagccgggtcgccacctcggcggcg
caggtgccgggcgcggtgcggctgccggggctggacccgcagcggcgctaccggatccgc
ccgcccgccggagtaccggaaccggccctgctggagctgtccccgccgggctggctggcc
tggccgggcgacggcatcacggtgagcggttcggtgctgggcacggtcggcgttcagctc
cccgccctgcaccccgaacaggccctcctcctggaggtcaccgtcgtcggctga

DBGET integrated database retrieval system