KEGG   Micromonospora aurantiaca: Micau_1715Help
Entry
Micau_1715        CDS       T01296                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
mau  Micromonospora aurantiaca
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Micau_1715
Enzymes [BR:mau01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Micau_1715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1796437..1798446
Genome map
AA seq 669 aa AA seqDB search
MRNWHGDGIWYGADYNPEQWPEQTWAEDVELMRRAGVNLVSVGIFSWALLEPAPGRYVFD
WLDRAIDLLHDGGISVDLATATASPPPWLAHRHPETLPRRADGTVLWPGGRQAYCPSSPV
FRDHSLALVEAVARRYARHPAVVLWHVSNELGCHNVHCYCDVSAEAFRGWLRERYGDLDS
LNAAWGTAFWSQRYHDWAEINPPRTAPTFANPTQQLDFLRFSSDEQRAQLRAERELLNRL
VPQPVTTNFMIGTGIKYLDYHSWASDVDVVSNDHYLTAADPQPQVNLALAADHTRGVAGG
APWLLMEHSTSAVNWQPRNVAKTPGQMRRNSLAHVARGADGVLFFQWRASRAGAEKFHSA
LVPHAGPDTKVFREVCRLGADLRALAEVRGSRVDADVAILFDYEAWWGAELDSHPSVDVT
YTDRLSALHAALWRAGVTADVVHPSADLSRYRLVLAPTLYLVRDADADSLRRFVEAGGTA
VVTYFSGIVDEHDHIRLGGYPGAFRDLLGVRVEEFFPLREGETVRLDDGARADVWTEWLH
AEGAEVLAAYTDGPLPGVPALTRHAVGAGAAWYVGTRLDDEATDRLVARLLAETGVRPPV
RAPAGVEVVRRRSADRSWLFVVNHTTEPARLAVSGVELLGGARCDGELEVPAGEVAVVRE
EPAPVPATA
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgcggaactggcacggcgacggcatctggtacggcgcggactacaacccggagcagtgg
cccgagcagacgtgggccgaggacgtcgaactcatgcgacgggccggggtcaacctggtc
tcggtcggcatcttctcctgggcactgctggagcccgcccccggccggtacgtcttcgac
tggctggaccgggcgatcgacctgctgcacgacggcggcatcagcgtcgacctggccacc
gccaccgccagcccgccaccgtggctggcgcaccggcacccggagacgctgccccgccgc
gccgacggcacggtgctctggcccggtggccggcaggcgtactgccccagctcaccggtg
ttccgggaccactcgctcgccctggtcgaggccgtcgcccgccggtacgcgcgccacccc
gccgtggtgctctggcacgtctccaacgaactcggctgccacaacgtgcactgctactgc
gacgtcagcgccgaggcgttccgcggctggctgcgcgagcgctacggcgacctggactcg
ctcaacgcggcctggggcaccgccttctggagccagcgctaccacgactgggccgagatc
aacccgccgcgtaccgcgccgacgttcgccaacccgacgcagcagctggacttcctgcgg
ttctcctccgacgagcagcgcgcccagctgcgcgccgagcgggaactgctgaaccggctc
gtcccgcagcccgtcaccacgaacttcatgatcggcaccggcatcaagtacctggactac
cactcctgggcctccgacgtggacgtcgtctccaacgaccactacctcaccgccgccgac
ccgcagccgcaggtcaacctcgcgctggccgccgaccacacccggggcgtcgccggtggc
gcgccgtggctgctgatggagcactccaccagcgccgtcaactggcagccccgaaacgtg
gccaagacgcccggccagatgcgccgcaacagtctcgcccacgtcgcgcgcggcgccgac
ggcgtgctgttcttccagtggcgggcctcccgggccggcgcggagaagttccactccgcg
ctggtgccgcacgccgggccggacaccaaggtgttccgcgaggtctgccggctcggcgcc
gacctgcgcgcgctcgccgaggtacgcggcagccgcgtcgacgccgacgtggcgatcctg
ttcgactacgaggcctggtggggtgccgaactcgactcccacccgagcgtcgacgtcacc
tacaccgaccggctgtcggcgctgcacgccgcgctgtggcgggccggggtcaccgccgac
gtggtgcacccgtcggccgacctgtcccgctaccggctcgtcctggcgcccacgctctac
ctcgtccgcgacgccgacgccgactcgctgcgccggttcgtggaggccggcggcaccgct
gtggtcacctacttcagcggcatcgtcgacgagcacgaccacatccggctcggcggttac
cccggcgcgttccgcgacctgctcggcgtacgcgtcgaggagttcttcccgctgcgggaa
ggcgagacggtacgcctcgacgacggcgcccgcgccgacgtgtggaccgagtggctgcac
gccgagggcgccgaggtgctggccgcgtacaccgacgggcccctgccgggcgtgccggcg
ctgacccggcacgcggtcggcgcgggcgccgcctggtacgtcggcacccggctcgacgac
gaggccaccgaccggctggtggcccggctcctcgccgagaccggcgtacgtccgccggtg
cgcgcgccggccggggtggaggtggtccgccgccgctcggcggaccggagctggctgttc
gtggtcaaccacaccaccgaaccggcccggctggcggtcagcggcgtcgagctgctcggc
ggcgcccgttgcgacggcgagctggaggtgccggcgggtgaggtggcggtggtccgcgag
gagcccgcgccggtgcccgcgaccgcctga

DBGET integrated database retrieval system