KEGG   Micromonospora aurantiaca: Micau_1760Help
Entry
Micau_1760        CDS       T01296                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mau  Micromonospora aurantiaca
Brite
Enzymes [BR:mau01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Micau_1760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1850994..1852271)
Genome map
AA seq 425 aa AA seqDB search
MADPLDTELTKMARARLVDTLLADGAITSPAVEAAFRRVPRHLFTPSGVSVEAAYADDVV
VTRRGPDGKATSSISAPWLQAAMLHAAHLQPGARVLEVGSGGYNAALIAEVVGPYGTVTS
IDIDPAVIAHARTALDTAGYPHVAAVHADADEGWAAAAPYDAIIVTVETSDIPPAWTDQL
TPDGVLVAPLRMRGHTRCLTLVRDSGHLVATNALVCGFVPIQGAGANPVTPHHLRGDDVT
VFIDDPVTEALDLRALPAALNGPRHDTWSPVTTPPATPFDTLQLWLASQPHPHGLLAVDR
QRAADLAPQNWVACPALLTADSIAYLATRQLDNTTWQFGAHGYGPHATTLTGHILDLIAA
WNRHHRHQPGPHIAVYPTGTAPSPTNHLRLLIPRPHTTIAITWPSKGPSTPARNTAANIR
RQTGL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggccgatccgctcgacaccgagctcacgaagatggctcgcgctcgactggtcgacacg
ttgctcgccgacggtgcgatcacctcaccggccgtggaagcggcattcagacgggtcccg
cggcacctgttcacgccctcgggagtcagtgtcgaggccgcgtacgccgacgacgtggtg
gtcacccgacgcggcccggacggcaaggcgaccagttcgatctccgcgccgtggcttcaa
gccgccatgctgcacgccgcccaccttcagcccggcgcacgggtgctggaggtcggatcc
ggcggctacaacgccgcgctcatcgccgaggtcgtcggcccatacggcacggtcaccagc
atcgacatcgaccccgccgtcatcgcccacgcccgcaccgccctcgacaccgccggctac
ccgcacgttgcggcggtgcacgccgacgcggacgaaggatgggcggcggccgccccgtac
gacgccatcatcgtcaccgtcgagaccagcgacatcccacccgcctggaccgaccagctc
acccccgacggcgtcctcgtcgccccacttcggatgcgaggccacacccgctgcctcacc
ctcgtccgcgacagcggacacctcgtcgccaccaatgccctcgtctgcggcttcgtcccg
atacaaggcgccggcgccaaccccgtcacaccacaccacctacgcggcgacgacgtcacc
gtattcatcgacgaccctgtcaccgaggccctggatctccgcgcgctgcccgccgccctc
aacggacctcggcacgacacctggtcaccggtcaccaccccaccggcgacccccttcgac
accctgcaactatggctggccagccaaccccaccctcacggtctactcgccgtcgatcgg
caacgcgccgccgacctggcaccgcagaactgggtggcctgcccggccctgctcaccgcc
gacagcatcgcctacctcgccacccgccaactcgacaacaccacctggcagttcggcgcc
cacggctacggaccccacgccaccacactcaccggccacatcctcgacctcatcgccgcc
tggaaccgccaccaccgacaccaacccggcccacacatcgccgtctaccccaccggcacc
gcacccagccccaccaaccacctgcggctactgatcccccgcccgcacaccaccatcgcg
atcacctggcccagcaagggcccctccacgcctgcgcgaaacaccgccgcaaacataagg
cggcagaccggtctgtga

DBGET integrated database retrieval system