KEGG   Micromonospora aurantiaca: Micau_2018Help
Entry
Micau_2018        CDS       T01296                                 

Definition
D-amino-acid oxidase (EC:1.4.3.3)
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
mau  Micromonospora aurantiaca
Pathway
Glycine, serine and threonine metabolism
Penicillin and cephalosporin biosynthesis
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Micau_2018
   00330 Arginine and proline metabolism
    Micau_2018
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    Micau_2018
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    Micau_2018
Enzymes [BR:mau01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     Micau_2018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2135196..2136149
Genome map
AA seq 317 aa AA seqDB search
MGVMTKADVVVVGGGVIGMTTALTLQRRGAHVTVLTAHDPADTVSTVAAAVWYPSHTEED
PRVLRWARDTHAELRRQAADGVPGVIDRPTRMWLRHRYAGPPWWADACGDLTAEPAEPPY
TALLRFTAPSVEMTPYLAWLRQRLEAGGGRIVGRALGTLAEAYEVAPVVVNATGLAAGRL
AADPAVYPARGHVLLVANPGLTVSVRDEDDPAGVTYVHPRRHDVVLGGTYEAGVGHTRPD
LEEAAAIRRRCVALVPHLADAPVLGERIGLRPARHGGPRVEVDATDGRLVHAYGHGGAGV
TLSWGCAAEVADLALGV
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtcatgacgaaggcggacgtggtggtggtcggcggcggggtgatcgggatgacg
acggcgctcacgctccagcggcggggcgcacacgtcaccgtcctgaccgcccacgacccg
gccgacacggtgtcgacggtggccgccgcggtctggtacccgagccacaccgaggaggat
ccccgggtgctgcgctgggcccgggacacccacgccgagctgcgccgccaggcggccgac
ggggtgccgggagtgatcgaccggcccacccggatgtggttgcgccaccgctacgccgga
ccgccctggtgggccgacgcctgcggcgacctgacggccgagccggcggagccgccgtac
accgcgctgctgcggttcaccgccccgtcggtggagatgaccccgtacctcgcctggctc
cggcagcgcctggaggcgggcggcggccggatcgtcggccgcgcgctgggcacgctcgcc
gaggcgtacgaggtcgccccggtcgtggtgaacgcgaccggcctggccgccggccggctc
gccgccgacccggccgtgtacccggcgcgcgggcacgtcctgctggtggcgaacccgggc
ctgaccgtctcggtacgcgacgaggacgacccggcaggagtcacgtacgtgcatccgcgc
cgccacgacgtggtgctcggcggcacctacgaggccggggtgggacacacccgccccgac
ctggaggaggcggcggcgatccggcgccggtgcgtggcgctggtgccgcatctcgcggac
gcgccggtgctgggggagcggatcgggctgcggccggcacggcacggcggcccccgggtg
gaggtggacgcgacggacgggcggctggtgcacgcgtacgggcacggcggcgccggggtg
acgctgtcctggggctgcgccgccgaggtggccgacctggccctgggcgtctga

DBGET integrated database retrieval system