KEGG   Micromonospora aurantiaca: Micau_2022Help
Entry
Micau_2022        CDS       T01296                                 

Definition
PfkB domain-containing protein
Orthology
K00882  
1-phosphofructokinase [EC:2.7.1.56]
Organism
mau  Micromonospora aurantiaca
Pathway
Fructose and mannose metabolism
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Micau_2022
Enzymes [BR:mau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.56  1-phosphofructokinase
     Micau_2022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2137878..2138804
Genome map
AA seq 308 aa AA seqDB search
MVFAPAPLLTVTIEQQGDVPELHLHPGGQGVWQTRMIAALGVPVTMCVGLGGEVGDAVRK
LLDDEDVTVRTVRRESGTGWYVHDRRDGERTEIAEHPGAPMVRHDIDELYTVTLTEGLRA
PVSVLSGPADPQVVDPDIYRRLAADLGANGGKVVADLSGPYLEAVLDGGVSVLKVSHEEL
LDDGLAKDDSVEALRDAGRRCQERGARTVLISRAGEPALALPEDGEPLLVHAPPLELADH
RGAGDSMTAGVAAVLARGGDMREALHIGAAAGALNVTRHGLGTGRAEAVRELAGRVRLTP
LDGGDDDG
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggtgttcgccccggccccgctgttgacggtgacgatcgagcagcagggcgacgtaccc
gagctgcacctgcaccccggcgggcagggggtgtggcagacccggatgatcgcggcgctc
ggcgtaccggtgaccatgtgcgtgggtctcggcggcgaggtgggcgacgcggtccgcaag
ctgctcgacgacgaggacgtcacggtccggacggtgcggcgggagtccggcaccggctgg
tacgtgcacgaccggcgcgacggcgagcggaccgagatcgccgagcacccgggggcgccg
atggtgcggcacgacatcgacgagctgtacacggtgacgctcaccgaagggctgcgcgcg
ccggtgagcgtgctcagcgggccggccgacccgcaggtggtggacccggacatctaccgc
cggctcgccgccgacctgggcgccaacggcggcaaggtggtggccgacctgtccgggccg
tacctggaggcggtgctcgacggcggcgtgagcgtgctgaaggtcagccacgaggagctg
ctcgacgacggcctggccaaggacgacagcgtcgaggcgctgcgcgacgccggccgccgg
tgccaggagcggggcgcgcggacggtgctgatcagccgcgcgggggagcccgcgctggcg
ctgccggaggacggcgagccgctgctggtgcacgccccgccgctggagctggccgaccac
cggggcgccggtgactcgatgaccgccggggtcgccgcggtgctggcccggggcggggac
atgcgggaggcgctgcacatcggcgccgccgcgggcgcgctgaacgtgacccggcacggg
ctgggcacgggccgggccgaggcggtacgcgaactggccggccgggtgcggctgaccccg
ctggacggtggcgacgatgacggctga

DBGET integrated database retrieval system