KEGG   Micromonospora aurantiaca: Micau_2032Help
Entry
Micau_2032        CDS       T01296                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
mau  Micromonospora aurantiaca
Pathway
mau00010  Glycolysis / Gluconeogenesis
mau00071  Fatty acid degradation
mau00350  Tyrosine metabolism
mau00625  Chloroalkane and chloroalkene degradation
mau00626  Naphthalene degradation
mau01100  Metabolic pathways
mau01110  Biosynthesis of secondary metabolites
mau01120  Microbial metabolism in diverse environments
mau01130  Biosynthesis of antibiotics
mau01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Micau_2032
  Lipid metabolism
   00071 Fatty acid degradation
    Micau_2032
  Amino acid metabolism
   00350 Tyrosine metabolism
    Micau_2032
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Micau_2032
   00626 Naphthalene degradation
    Micau_2032
Enzymes [BR:mau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Micau_2032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 ELFV_dehydrog Methyltransf_25 Methyltransf_11 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ADL45578
JGI: Micau_2032
UniProt: D9T350
Position
complement(2151861..2152907)
Genome map
AA seq 348 aa AA seqDB search
MRAVVFEQFGGRPEVREVDDPVPAPDGVVVRVGATGLCRSDWHGWQGHDPDIRLPHVPGH
EFAGVVVATGADVRGWRPGDRVTAPFVCACGRCPSCLAGDQQVCERQTQPGFTGWGSFAD
LVAVRHADVNLVRLPDELDEAAAAALGCRFATAFRAVVAQGRVAAGEWMAVHGCGGVGLS
AVMVATASGARVVAVDVSSGALELARRSGAAVCVDASALGGPAEVAAAIREATGGGAHLS
LDALGSHATCVASIEGLRRRGRHVQVGLLPAAQGRPALPMDLVIGYELELRGSHGMPAHA
YPEMLRLVTAGVLRPAELVTRTIDLDAAPDALATMDRPATAGMCLIRP
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcggtggtgttcgagcagttcgggggacggccggaggtccgggaggtggacgac
ccggtgccggcgccggacggggtggtcgtccgggtcggcgcgaccggcctgtgccgcagc
gactggcacggctggcagggccacgacccggacatccgcctgccgcacgtgccggggcac
gagttcgccggtgtcgtcgtggccaccggcgcggacgtacgcggctggcggcccggcgac
cgggtgacagcgccgttcgtctgcgcgtgcgggcggtgcccgtcctgcctggccggcgac
cagcaggtctgcgagcggcagacccagccgggcttcaccgggtggggctcgttcgccgac
ctggtcgcggtacggcacgccgacgtcaacctggtccggctgccggacgagctggacgag
gcggccgctgccgcgctcggctgccggttcgccaccgcgttccgggccgtcgtcgcgcag
ggccgggtcgcggcgggcgagtggatggccgtgcacggctgcggcggcgtcggcctgtcc
gcggtcatggtggcgacggcgagcggggcgcgggtggtggcggtggacgtgtcgtccggc
gcgctggagctggcccgccgcagcggcgccgcggtctgcgtggacgcgagcgcgctcggc
ggtcccgccgaggtggccgccgcgatccgggaggccaccggcgggggcgcccacctgtcg
ctggacgcgctcggcagtcacgccacctgcgtcgcgtcgatcgagggcctgcgccggcgc
ggccggcacgtgcaggtcgggctgctgcccgccgcgcagggccggcccgcgctgccgatg
gacctggtgatcgggtacgagctggagctgcgcggcagccacggcatgccggcgcacgcg
tacccggagatgctgcggctggtcaccgccggggtgctgcgcccggccgagctggtcacc
cgcaccatcgacctcgacgccgcgcctgacgcgctggccacgatggaccggccggccacc
gccgggatgtgcctgatccggccctga

DBGET integrated database retrieval system