KEGG   Micromonospora aurantiaca: Micau_2106Help
Entry
Micau_2106        CDS       T01296                                 

Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mau  Micromonospora aurantiaca
Pathway
mau00500  Starch and sucrose metabolism
mau01100  Metabolic pathways
mau01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Micau_2106
Enzymes [BR:mau01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Micau_2106
Exosome [BR:mau04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Micau_2106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase DUF3459 Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: ADL45651
JGI: Micau_2106
UniProt: D9T3C3
Position
complement(2234492..2236594)
Genome map
AA seq 700 aa AA seqDB search
MDQLIAGEVHDPHAVLGAHPADGSTTIRTLRRGAGEVAVLADGERHPMKRVHDAGVFEAV
LPGEVLDYRVEVDGTTHDDPYRYPPTLGDLDLHLIGEGRHERLWAALGARVFDEGVAFTV
WAPNARAVRLIGDVTGWAPDDGWPMRSLGSSGVWEIFVPGMPVGSRYKYRVLGADGRWRD
KADPMAARTEVPPATASVVHESRYEWGDADWLARRSRQAPHQEPMSVYEVHLGSWRPGLG
YRELAEQLTAYVLEMGFTHVEFLPVMEHPFGGSWGYQVTGYYAPTARFGDPDDFRHLVDR
LHAAGIGVLLDWVPAHFPKDEWALARFDGTPLYEHPDPRRGEHPDWGTYVFDFGRNEVRN
FLVANALYWLDEFHIDGLRVDAVASMLYLDYSRQDGQWAPNVHGGRENLEAIAFLQEVNA
TVYRHHPGVLMIAEESTAWPGVTRPTSEGGLGFGFKWNMGWMHDTLLYTSKDPVYRQHHH
HQLTFSLAYAWSENYVLPISHDEVVHGKGSLAGKMPGDTWQRLATVRALLAYMWAHPGKQ
LLFMGCELADDREWSEERGLDWYLTHDPARAGVQRLVADLNRVYRESPALWAQDTDPAGF
RWIAGDDVANNAVSFIRIAPDGQTLVCVANFSALPLEDYRIGLPAGGTWTEALNTDAHHY
GGSGVGNLGEVHAENVPWHGLPASVSLRVPPLGVLWLRPA
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atggaccagctgatcgccggcgaggtacacgacccgcacgccgtgctcggcgcgcacccg
gccgacgggagcaccacgatccggacgctgcgccggggcgcgggcgaggtggcggtgctc
gccgacggcgagcggcacccgatgaagcgggtgcacgacgccggtgtcttcgaggcggtc
ctccccggcgaggtgctcgactaccgggtcgaggtggacggcacgacgcacgacgacccg
taccgttatccgcccacgctcggcgacctcgacctgcacctgatcggcgaggggcggcac
gagcggctctgggcggctctcggcgcccgggtgttcgacgagggcgtcgcgttcaccgtc
tgggcgccgaacgcgcgggccgtgcggctgatcggcgacgtcaccggctgggcgccggac
gacgggtggccgatgcgctcgctcggctccagcggcgtgtgggagatcttcgtgccgggc
atgccggtgggcagccgctacaagtaccgcgtcctcggcgcggacggccggtggcgggac
aaggccgacccgatggccgcgcgcaccgaggtgccgccggccaccgcgtcggtggtgcac
gagtcacggtacgagtggggcgacgcggactggctcgcgcgccggtcccggcaggcgccg
caccaggagccgatgagcgtgtacgaggtgcacctgggctcctggcggcccggcctcggc
taccgggagctggccgagcagctcaccgcgtacgtgctggagatgggcttcacccacgtg
gagttcctgccggtgatggagcacccgttcggcggctcgtggggctaccaggtcaccggc
tactacgcgccgacggcccggttcggcgacccggacgacttccgtcacctggtggaccgg
ctgcacgccgccggcatcggcgtgctcctggactgggtgccggcgcacttcccgaaggac
gagtgggcgctcgcccgtttcgacggcaccccgctgtacgagcaccccgacccgcgtcgc
ggcgagcaccccgactggggcacgtacgtcttcgacttcggccgcaacgaggtgcgcaac
ttcctcgtcgccaacgcgctgtactggctcgacgagttccacatcgacggactgcgggtg
gacgcggtcgcctcgatgctctacctggactattcccggcaggacgggcagtgggcgccg
aacgtgcacggcggccgggagaacctggaggccatcgcgttcctccaggaggtcaacgcc
accgtctaccggcaccacccgggcgtactgatgatcgccgaggagtccaccgcctggccc
ggcgtcacccggcccacctcggagggcgggctcgggttcgggttcaagtggaacatgggc
tggatgcacgacaccctgctctacacctcgaaggacccggtctaccggcagcaccaccac
catcagctcacgttctcgctggcgtacgcgtggagcgagaactacgtgctgccgatcagc
cacgacgaggtggtgcacggcaagggctcgctcgccggcaagatgcccggcgacacctgg
cagcggctggccacggtgcgggcgctgctggcgtacatgtgggcgcacccgggcaagcaa
ctgctgttcatgggctgcgagctggccgacgacagggagtggagcgaggagcgcggcctc
gactggtacctgacccacgatccggcccgcgcgggcgtgcagcggctggtggccgacctg
aaccgggtctaccgggagagcccggcgctctgggcgcaggacaccgacccggccggcttc
cgctggatcgccggggacgacgtggccaacaacgcggtgtcgttcatccggatcgccccg
gacgggcagacgctcgtgtgcgtggcgaacttctccgcgctgccgctggaggactaccgg
atcggcctgccggccggcgggacgtggaccgaggcgctgaacaccgacgcccaccactac
ggcgggtcgggggtgggcaacctgggcgaggtgcacgccgagaacgtcccgtggcacggc
ctgcccgcgtcggtctccctgcgcgtgccgccgctgggcgtcctctggctccgcccggcc
tga

DBGET integrated database retrieval system