KEGG   Micromonospora aurantiaca: Micau_2232Help
Entry
Micau_2232        CDS       T01296                                 

Definition
glycoside hydrolase family 3 domain-containing protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mau  Micromonospora aurantiaca
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mau00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:mau00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2374613..2376112
Genome map
AA seq 499 aa AA seqDB search
MSERTEGSTGDLAALAAAVLQPGFVGTTPPPWVCRWLGEGLGSVVLFARNVVDHEQVATL
TANLRAERPDVIVAIDEEAGDVTRIESARGSSRPGNYALGAVDDPALTEEVARDLGAELA
AVGVTLDYAPDADVNSNPANPVIGVRSFGADPDMVARHTAAWVRGLQAGGVAACAKHFPG
HGDTRVDSHHDLPRIGGDLARLDAVELAPFRAAVAAGVQAVMTGHLLVPALDPELPATLS
PRVLGGLLREEMGFGGVVVTDAVEMRAVADRYGFTGAAVRALVAGADAICVGGERATEAD
ARELRDAIVAAVISGELPEERLAEAAKRVGQLAAWSVAARARRATGTPPADGSPIGLAAA
RRAVRVTGDAGLLPLTGPAHVVEFAPPRNIAIGEETPWGIAAPLAHLAPGTTTARYAADA
LPADPGATPAGRPLVLVVRDLHRHDWMRDAVRRALTARPDAVVVELGVPELVTGAVHLAT
HGATAAAARAAAEVLTGAR
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcggaccgagggatcgaccggagacctggcggcgctcgccgccgccgtcctg
caaccggggttcgtcggcaccacaccgccgccgtgggtgtgccgctggctcggcgagggc
ctcggctcggtggtcctgttcgcccgcaacgtcgtcgaccacgagcaggtcgccacgctc
accgcgaacctgcgcgccgagcggcccgacgtcatcgtggcgatcgacgaggaggccggc
gacgtcacgcggatcgagtccgcccggggcagttcccgtcccggcaactacgcgctcggc
gctgtcgacgacccggcgctgaccgaggaggtcgcccgcgacctgggcgccgaactcgcg
gccgtcggcgtcacgctggactacgccccggacgccgacgtcaactccaacccggccaac
ccggtcatcggggtgcgctccttcggcgccgacccggacatggtcgcccggcacaccgcc
gcctgggtacgcggcctccaggccggcggcgtcgccgcctgcgccaagcacttccccggg
cacggcgacacccgtgtcgactcgcaccacgacctgccccgcatcggcggcgacctggcc
cgcctcgacgcggtcgagctggccccgttccgcgccgccgtggccgccggggtgcaggcg
gtgatgaccggccacctgctggtgccggcgctggacccggagctgcccgccacgctcagc
ccgcgcgtgctcggcggcctgctgcgcgaggagatgggcttcggcggcgtggtggtcacc
gacgcggtggagatgcgcgcggtggccgaccggtacggcttcaccggcgccgccgtgcgc
gcgctcgtggccggcgcggacgcgatctgcgtcggcggggaacgggccaccgaggccgac
gcccgcgagctgcgcgacgcgatcgtcgcggcggtgatcagcggggagctgcccgaggag
cggctcgccgaggcggccaagcgcgtcggtcagctcgccgcgtggagcgtcgccgcccgc
gcccgccgggccaccggcacgccgcccgccgacggctcaccgatcgggctcgccgccgcc
cgccgcgcggtccgggtcaccggcgacgccgggctgctgccgctgaccggtccggcccac
gtcgtggagttcgcgcccccgcgcaacatcgccatcggcgaggagacgccgtggggcatc
gccgcaccgctggcccacctggcgcccggcaccaccaccgcccgctacgccgccgacgcc
ctaccggccgacccgggcgcgacgcccgccggccggccgctggtgctcgtggtgcgcgac
ctgcaccggcacgactggatgcgggacgcggtacgccgcgcgctcaccgcccgcccggac
gcggtggtggtcgagctgggcgtgcccgagctggtcaccggtgcggtgcacctggccacc
cacggcgccaccgccgcggcggcacgggccgccgccgaggtgctgaccggggcgcgctga

DBGET integrated database retrieval system