KEGG   Micromonospora aurantiaca: Micau_2289Help
Entry
Micau_2289        CDS       T01296                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mau  Micromonospora aurantiaca
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mau00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Micau_2289
Enzymes [BR:mau01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Micau_2289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2433451..2434053
Genome map
AA seq 200 aa AA seqDB search
MIASVRGTVTATGPDHAVVEVGGIGLAVQCAPGTLADLRVGQPARLATSLVVREDSLTLY
GFADDDAKQLFELLQTASGVGPRLAQAVLAVHTPDAVRKAIANADTAALTRVPGIGKKGA
ERLVLELRDRVGPVPVGADGAAGVTAGAWPEQVRQALVGLGWTAGQAEQAVAAVAETVDG
ETPPVPVLLKQAIRLLGRNR
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcgagcgtacgcggcacggtgaccgccaccggcccggatcacgcggtggtggag
gtgggcggcatcggcctggccgtgcagtgcgctcccggcacgctcgccgacctgcgcgtg
ggccagcccgcccggctcgccaccagccttgtggtccgggaggactcgctcaccctctac
ggcttcgccgacgacgacgccaagcagctgttcgagctgctccagaccgccagcggggtc
ggtccccggctggcccaggcggtgctcgccgtgcacacgccggacgcggtccgcaaggcc
atcgccaacgccgacaccgccgcgctgacccgggtgccgggcatcggcaagaagggtgcc
gagcggctggtgctggagctgcgcgaccgggtcggcccggtgccggtgggcgccgacggc
gcggccggggtgaccgcgggcgcctggccggagcaggtccgccaggccctcgtcgggctc
ggctggacggccgggcaggcggagcaggcggtggccgcggtggcggagaccgtcgacggc
gagaccccgccggtgccggtgctgctcaagcaggcgatccgcctcctgggccggaaccga
tga

DBGET integrated database retrieval system