KEGG   Micromonospora aurantiaca: Micau_2332Help
Entry
Micau_2332        CDS       T01296                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mau  Micromonospora aurantiaca
Pathway
mau00240  Pyrimidine metabolism
mau00250  Alanine, aspartate and glutamate metabolism
mau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Micau_2332
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Micau_2332
Enzymes [BR:mau01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Micau_2332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ADL45876
JGI: Micau_2332
UniProt: D9T5S4
Position
2475658..2476584
Genome map
AA seq 308 aa AA seqDB search
MIRHLLSGADLDAGTATLVLDTAAEMATVAGREVKKLPALRGRTVVNLFYEDSTRTRISF
EAAAKRLSADVINFSAKGSSVAKGESLKDTALTLQAMGADAVVVRHPASGAPHRLAEWVD
GSVVNAGDGTHEHPTQALLDAYTMRSRLGRLDGLHVAIVGDVLHSRVARSNVLLLSTLGA
KVTLVGPPTLIPVDIAAALATGTDVCYDLDAVLPDVDVVMMLRVQRERMGDSYFPSAREY
ARRYGLDGPRMRRLPEHAIVMHPGPMNRGMEITPEVADSPRSTIVEQVANGVSVRMAVLY
LLLGGNNR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgatccggcacctgctctccggcgccgatctggacgccggcaccgccaccctggtcctg
gacaccgccgcggagatggcgacggtggccggccgcgaggtcaagaagctgcccgcgctg
cgcgggcgcaccgtggtcaacctcttctacgaggactccacccgcacccggatctcgttc
gaggcggccgccaagcggctcagcgccgacgtgatcaacttctccgccaagggctccagc
gtggccaagggggagagcctgaaggacaccgcgctcacgctccaggccatgggcgcggac
gcggtcgtcgtccggcaccccgcctccggcgcaccgcaccggctcgccgagtgggtggac
ggatcggtggtcaacgccggtgacggcacccacgagcaccccacccaggcgctgctcgac
gcgtacacgatgcggtcccggctgggccgcctcgacggcctgcacgtggcgatcgtcggc
gacgtgctgcactcccgggtggcccgctccaacgtgctgctgctgtccaccctcggcgcg
aaggtgacactggtcggcccgcccaccctcatcccggtcgacatcgccgccgccctggcc
accggcaccgacgtctgttacgacctcgacgccgttctcccagatgtggacgtggtgatg
atgctgcgggtgcagcgcgagcggatgggtgactcctacttcccgtcggcccgcgagtac
gcccgacgctacgggctcgacgggccgcgcatgcgccggctgcccgagcacgcgatcgtc
atgcaccccggcccgatgaaccggggcatggagatcacgcccgaggtggccgactcgccc
cgctccaccatcgtcgaacaggtcgccaacggggtctccgtgcggatggccgtgctctac
ctgctgctcggagggaacaaccggtga

DBGET integrated database retrieval system