KEGG   Micromonospora aurantiaca: Micau_2341Help
Entry
Micau_2341        CDS       T01296                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mau  Micromonospora aurantiaca
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:mau00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2486421..2486972
Genome map
AA seq 183 aa AA seqDB search
MSTDDEARSAARLTVLSGPSGAGRSSVVEAVRARLASVCVPVVATTRPPRPDERDGVDRV
FLDAPGFDRLIAAGELLEWCRIGPYRRGVPRAEVRARLAEGRPVLLPLDLAGALAVRAAA
PGARLVLLAPPAYRADPDVAALFAHAVAHDHTERAAAELVGLLGSSFLAPARPPAGGARD
AEV
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacggatgacgaggcgcgctcggcggctcggctcactgtcctgtccggtccctcc
ggggccggccggagcagtgtcgtcgaggcggtccgggcgcgccttgcgtctgtctgcgtg
ccggtggtcgccaccacccgcccaccccgtccggacgagcgtgacggcgtcgaccgcgtc
ttcctcgacgcgcccggcttcgaccggctgatcgccgcgggcgagctgctggagtggtgc
cggatcgggccgtaccgccggggggtgccccgggccgaggtgcgggcgcggctcgcggag
ggacggccggtgctgctgccgctggacctggccggcgcgctggcggtacgggcggcggcg
cccggcgcccggctggtgctgctcgcgcccccggcgtaccgggccgacccggacgtcgcg
gccctcttcgcccatgccgtggcacacgaccacaccgagcgcgccgcggcggagctggta
ggattgctcggttcgtccttcctggctccggcccgaccgcccgcgggcggcgcacgagac
gcagaggtttaa

DBGET integrated database retrieval system