KEGG   Micromonospora aurantiaca: Micau_2417Help
Entry
Micau_2417        CDS       T01296                                 

Definition
NUDIX hydrolase
Orthology
K01515  
ADP-ribose pyrophosphatase [EC:3.6.1.13]
Organism
mau  Micromonospora aurantiaca
Pathway
Purine metabolism
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:mau00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2576417..2577022
Genome map
AA seq 201 aa AA seqDB search
MSGVEHRYEVTGRREIWSGRIFSVVSDDVTMPGGGSATRDYVRHVGAVAVVALDDAGQVV
LIRQYRHPVGRHLWELPAGLMDVGGEDLAAAALRELAEEADLTAGRVDVLVDLHSSPGFA
DEVVRVFLARDLADVPADQRHDRHDEEADLQVVRVDLDEAVRMVLAGEITNASCVAGLLA
AARARDTGFTELRRPEAPLPR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggcgtcgagcaccggtacgaggtgaccggccgccgggagatctggtccggccgg
atcttctccgtggtcagcgacgacgtcaccatgcccggcggcggcagcgcgacccgcgac
tacgtgcggcacgtcggcgcggtcgccgtggtggcgctcgacgacgccggtcaggtggtg
ctgatccgccagtaccggcacccggtcggccggcacctgtgggagctgcccgccgggctg
atggacgtcggcggcgaggacctggccgccgccgcgctgcgggagctggccgaggaggcg
gacctgaccgccgggcgcgtcgacgtgctcgtcgacctgcacagctcgcccggtttcgcc
gacgaggtggtgcgggtgttcctggcccgcgacctcgccgacgtgccggccgatcagcgg
cacgaccggcacgacgaggaggccgacctccaggtggtccgcgtggacctggacgaggcg
gtgcggatggtgctggccggcgagatcaccaacgcgtcctgcgtggccgggctgctcgcc
gccgcccgcgcccgcgacaccggcttcaccgagctgcgccgcccggaggcgccgctgccg
cgctga

DBGET integrated database retrieval system