KEGG   Micromonospora aurantiaca: Micau_2519Help
Entry
Micau_2519        CDS       T01296                                 

Definition
GMC oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
mau  Micromonospora aurantiaca
Brite
KEGG Orthology (KO) [BR:mau00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Micau_2519
Enzymes [BR:mau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Micau_2519
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2860724..2862421
Genome map
AA seq 565 aa AA seqDB search
METHEHVDAVVVGSGFGGSVAAYRLAEAGRRTVVLERGRPYPPGSFPRTPQEMGRAFWDP
SEGLYGLFDVWTFRGLESVVASGLGGGSLIYANVLLRKDEHWFVTEDPVPGAGHENWPVT
RADLDPHYDRVERMLGASRFPADRPPYRSVPKAAAMRTAAERLGLAYQYPPLAVSFAPGP
GAEPVPAALIAEPAYGNLHAAPRRTCRLCGECDIGCNDGAKNTLDHTYLSAARWHGAELR
TRAEVRSIRPRRGGGYEVRYLVHDPVDEDRRSDGRARPGRTITCDRLVLAAGTYGTTYLL
LRNRHQLPAVGPALGTRFSGNGDLLGLIRPPRRGDATRFSASRGPVITTAIRVGDAHDGD
GSPGRGFYLQDGGYPGFVDWLAESSRLSGASARRLRFAVDWLSARLTGSPRSGLGGGLAR
LLGDGRLSAGSLPLLGMGRDVPDGVFRLRGDHLDVDWTTRTSAGYFAAVRSTMRAVADVL
GGRYTDNPAWWLRRVVTVHPLGGAPMGRHRGDGVCDGHGQVFGHPGLYVLDGSAMPGPVG
PNPALTIAAVADRALDRLLGEPAGR
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atggaaacccacgagcacgtcgacgcggtggtcgtcggctccggattcggcggctcggtc
gccgcgtaccggctggcggaggcgggccgccgcaccgtggtgctggagcgcgggcggccg
tacccgccgggcagcttcccgcgtacgccgcaggagatgggccgggcgttctgggatccg
agcgaagggctgtacggcctgttcgacgtgtggaccttccggggactggagtcggtggtg
gccagcggtctcggcggcggctccctgatctacgcgaacgtcctgctgcgcaaggacgag
cactggttcgtcaccgaggatccggtgcccggcgccggccatgagaactggccggtgacc
cgggccgacctggacccgcactacgaccgggtcgagcggatgctgggcgccagccggttc
ccggccgaccgtccgccgtaccgctcggtgcccaaggcggcggcgatgaggacggcagcc
gaacggctgggactggcgtaccagtacccgccgctcgcggtcagcttcgctccggggccg
ggcgcggagccggtcccggccgcgctgatcgccgagccggcgtacggcaacctgcacgcc
gcgccgcgccgcacctgccggttgtgcggagagtgcgacatcggctgcaacgacggcgcc
aagaacaccctcgaccacacctacctgtcggcggcccggtggcacggcgcggagctgcgg
acccgcgccgaggtccggtcgatccgcccccggcgcggcggcgggtacgaggtccggtat
ctcgtacacgacccggtcgacgaggaccggcggagcgacggccgcgcccggccgggcagg
acgatcacctgtgaccgtctggtgctcgccgcgggcacgtacggcaccacgtacctgctg
ctgcggaaccggcaccagctgcccgccgtcggcccggcactcggcacccggttcagcggc
aacggtgatctgctcgggctgatccggccgccacgtcgcggcgacgccacccgcttctcg
gcaagccgcgggcccgtcatcaccacggccatccgggtgggggacgcgcacgacggggac
ggctctccgggccgcggcttctatcttcaggacggcggctaccccgggttcgtggactgg
ctggcggagtcgtcccggctgtccggcgcctcggcccgccggctgcggttcgctgtggac
tggctgtcggcccggctcaccggctcgccccgcagcggtctgggcgggggactggcccgg
ctgctcggcgacggccggctctccgccggctcgctgccgctcctcggtatgggacgggac
gtgccggacggcgtgttccggctgcgcggcgaccacctcgacgtggactggacgacccgg
accagcgccggctatttcgcggcggtccggtccacgatgcgagcggtggccgacgtcctg
ggtggccgctacaccgacaaccccgcgtggtggctgcgccgggtggtcaccgtccatccg
ctcgggggcgcgccgatgggccgccaccggggggacggggtgtgcgacgggcacggccag
gtgttcggtcatcccggcctctacgtgctcgacggctcggcgatgcccgggccggtggga
ccgaatccggcgctcacgatcgcggcggtggccgaccgggccctggaccggctgctgggg
gagccggcggggcggtag

  All links  
No link information was found.   
DBGET integrated database retrieval system